| Sequence 1: | NP_001261387.1 | Gene: | CG12605 / 38468 | FlyBaseID: | FBgn0035481 | Length: | 619 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_650861.1 | Gene: | trem / 42392 | FlyBaseID: | FBgn0038767 | Length: | 439 | Species: | Drosophila melanogaster |
| Alignment Length: | 319 | Identity: | 78/319 - (24%) |
|---|---|---|---|
| Similarity: | 115/319 - (36%) | Gaps: | 78/319 - (24%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 336 DMSSSSESGLQQWGKPNPQQNQQRASALKMCLNMLDGRTKASKAAAVTKQDRQEPMQP------- 393
Fly 394 -----------------RPKSAQSNASSGGG-PPSEPPENPAAS--------------------- 419
Fly 420 ------LGHSSSGNGENYAKR-------KRGCYKCCECGKQYATSSNLSRHKQTHRSLDSQSAKK 471
Fly 472 CNTCGKAYVSMPALAMHLLTH--KLSHSCDICGKLFSRPWLLQGHLRSHTGEKPYACVHCGKAFA 534
Fly 535 DRSNLRAHMQTHSGDKNFKCHRCNKTFALKSY-LNKHLESACLRDAGAIDQGKGLEEED 592 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG12605 | NP_001261387.1 | zf-C2H2 | 439..461 | CDD:278523 | 8/21 (38%) |
| C2H2 Zn finger | 441..461 | CDD:275370 | 7/19 (37%) | ||
| C2H2 Zn finger | 472..492 | CDD:275368 | 6/19 (32%) | ||
| COG5048 | 492..>570 | CDD:227381 | 27/80 (34%) | ||
| zf-C2H2 | 496..518 | CDD:278523 | 5/21 (24%) | ||
| C2H2 Zn finger | 498..518 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 511..534 | CDD:290200 | 9/22 (41%) | ||
| zf-C2H2 | 524..546 | CDD:278523 | 7/21 (33%) | ||
| C2H2 Zn finger | 526..546 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 538..562 | CDD:290200 | 9/23 (39%) | ||
| C2H2 Zn finger | 554..571 | CDD:275368 | 7/17 (41%) | ||
| trem | NP_650861.1 | zf-AD | 11..87 | CDD:214871 | |
| COG5048 | <264..411 | CDD:227381 | 47/150 (31%) | ||
| C2H2 Zn finger | 274..294 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 287..311 | CDD:290200 | 6/26 (23%) | ||
| C2H2 Zn finger | 302..322 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 315..338 | CDD:290200 | 6/22 (27%) | ||
| C2H2 Zn finger | 330..350 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 345..367 | CDD:290200 | 10/21 (48%) | ||
| C2H2 Zn finger | 358..378 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 370..394 | CDD:290200 | 10/24 (42%) | ||
| C2H2 Zn finger | 386..406 | CDD:275368 | 9/20 (45%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR23226 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||