DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12605 and CG7691

DIOPT Version :9

Sequence 1:NP_001261387.1 Gene:CG12605 / 38468 FlyBaseID:FBgn0035481 Length:619 Species:Drosophila melanogaster
Sequence 2:NP_650728.1 Gene:CG7691 / 42228 FlyBaseID:FBgn0038626 Length:283 Species:Drosophila melanogaster


Alignment Length:303 Identity:77/303 - (25%)
Similarity:116/303 - (38%) Gaps:69/303 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   299 RFIGSSS--YDLMGGSSEGANNCSPLTPPNSDHSSDVDIDMSSSSESGLQQWGKPNPQQNQQRAS 361
            |:.|...  ||......:...|..|:..|.::|.|.|..              ||.|:.|.:   
  Fly    12 RYNGKQERFYDRYEDFCQVIPNLPPMPRPKTNHHSRVAT--------------KPEPKTNVK--- 59

  Fly   362 ALKMCLNMLDGRTKAS-------KAAAVTKQDRQEPMQPRPKSAQSNASSGGGPPSEPPENPAAS 419
             ...|.    |:::.|       ....|.:::.:|.:             |....|..|...::.
  Fly    60 -FTYCF----GQSEPSGDWRQGDDIPIVVRREMEERL-------------GIQLMSVLPITESSL 106

  Fly   420 LGHS---SSGNGENY---AKRKRGCYKCCECGKQYATSSNLSRHKQTHRSLDSQSAKKCN-TCGK 477
            |.|:   ....||::   .|.:.|    .:.|....|:.:    |||...|..:.....| |...
  Fly   107 LSHTIWELKMPGESFDSIPKTRNG----IKVGIITVTAES----KQTRTKLKRKGPILANVTVPS 163

  Fly   478 AYVSMPALAMHLLTHKL-------SHSCDICGKLFSRPWLLQGHLRSHTGEKPYACV--HCGKAF 533
            ..|.:|.:....:..|.       ...|..|.|.|...|:|..|.|:||||||:.|.  .|.|||
  Fly   164 NIVEIPPIQQRKMPEKRRLKRVGGQFECIDCDKKFDHSWMLTAHTRTHTGEKPFVCPDGSCRKAF 228

  Fly   534 ADRSNLRAHMQTHSGDK-NFKCHRCNKTFALKSYLNKHLESAC 575
            :||||||:|.:|....: ..:|.:|.|.|:..||||:|...||
  Fly   229 SDRSNLRSHQRTMGHHEWQHQCGQCGKYFSQFSYLNRHSLDAC 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12605NP_001261387.1 zf-C2H2 439..461 CDD:278523 4/21 (19%)
C2H2 Zn finger 441..461 CDD:275370 4/19 (21%)
C2H2 Zn finger 472..492 CDD:275368 4/20 (20%)
COG5048 492..>570 CDD:227381 36/87 (41%)
zf-C2H2 496..518 CDD:278523 8/21 (38%)
C2H2 Zn finger 498..518 CDD:275368 8/19 (42%)
zf-H2C2_2 511..534 CDD:290200 13/24 (54%)
zf-C2H2 524..546 CDD:278523 12/23 (52%)
C2H2 Zn finger 526..546 CDD:275368 12/21 (57%)
zf-H2C2_2 538..562 CDD:290200 8/24 (33%)
C2H2 Zn finger 554..571 CDD:275368 8/16 (50%)
CG7691NP_650728.1 COG5048 188..>271 CDD:227381 36/82 (44%)
C2H2 Zn finger 191..211 CDD:275368 8/19 (42%)
zf-H2C2_2 203..229 CDD:290200 13/25 (52%)
C2H2 Zn finger 219..244 CDD:275368 13/24 (54%)
C2H2 Zn finger 250..266 CDD:275368 8/15 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2462
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.