DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12605 and CG14710

DIOPT Version :9

Sequence 1:NP_001261387.1 Gene:CG12605 / 38468 FlyBaseID:FBgn0035481 Length:619 Species:Drosophila melanogaster
Sequence 2:NP_650092.4 Gene:CG14710 / 41393 FlyBaseID:FBgn0037920 Length:415 Species:Drosophila melanogaster


Alignment Length:432 Identity:93/432 - (21%)
Similarity:142/432 - (32%) Gaps:134/432 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 SLRRPVGRAPAEDGKVIFYAPPASASGSPRQPEPVALKRERERDKEREREKERERDRMREQQLVA 229
            |..||...|.|.|.:.:.|.           .|.:.||...|..::.|.....|.|..:|.|...
  Fly    85 SSERPEALAQASDAEYMLYL-----------YENLHLKLGTENQEKEEITAIEEGDEQQEDQSQE 138

  Fly   230 ATAAASIYRGRSVEETEAAHD------LLSLSQSLPPLIPPCVVTIMKQEQEQL---RSPEIQEI 285
            ...........|:||.|..:.      |:|...|.          :..|:.|:|   :...::|:
  Fly   139 VLDFNGFIINESIEEDEEPNTESPEQILISHMDSY----------VDDQQMEELIDDKGELVEEL 193

  Fly   286 SNSASSRSPQSTIRFIGSSSYDLMGGSSEGANNCSPLTPPNSDHSSDVDIDMSSSSESGLQQWGK 350
            ||:              ::.|::..|                    |.::.|||:          
  Fly   194 SNA--------------NTFYEVEYG--------------------DEELLMSSA---------- 214

  Fly   351 PNPQQNQQRASALKMCLNMLDGRTKASKAAAVTKQDRQEPMQPRPKSAQ-------SNASSGGGP 408
            |:|..:                          .|.|:|:|.:||...|:       .||...|..
  Fly   215 PSPHPS--------------------------FKMDKQKPGRPRKPDAELKFKRKDINAKERGNQ 253

  Fly   409 PSEPPENPAASLGHSSSGNGENYAKRKRGCYKCCECGKQYATSSNLSRHKQTHRSLDSQSAKKCN 473
            |....|..                      :.|..||..:...|..:.|..||   ......:|.
  Fly   254 PKCKEEEK----------------------FMCILCGNVFYKKSVFTAHMMTH---SEYKPHQCE 293

  Fly   474 TCGKAYVSMPALAMHLLTH--KLSHSCDICGKLFSRPWLLQGHLRSHTGEKPYACVHCGKAFADR 536
            .|.|::..|..|..|:..|  ...:.|..|.:.|........|.|.||..:||||..|||.|...
  Fly   294 ICNKSFRQMGELRAHIRRHTGDRPYKCMYCDRHFYDRSERVRHERVHTNTRPYACQECGKTFTHT 358

  Fly   537 SNLRAHMQTHSGDKNFKCHRCNKTFALKSYLNKHLESACLRD 578
            :.|:.|:.:||..||:.|..|.|:|.|...|..||::...|:
  Fly   359 AILKNHILSHSAQKNYNCGICCKSFTLLHQLKAHLQTLTHRN 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12605NP_001261387.1 zf-C2H2 439..461 CDD:278523 5/21 (24%)
C2H2 Zn finger 441..461 CDD:275370 5/19 (26%)
C2H2 Zn finger 472..492 CDD:275368 6/19 (32%)
COG5048 492..>570 CDD:227381 28/79 (35%)
zf-C2H2 496..518 CDD:278523 5/21 (24%)
C2H2 Zn finger 498..518 CDD:275368 5/19 (26%)
zf-H2C2_2 511..534 CDD:290200 11/22 (50%)
zf-C2H2 524..546 CDD:278523 9/21 (43%)
C2H2 Zn finger 526..546 CDD:275368 7/19 (37%)
zf-H2C2_2 538..562 CDD:290200 9/23 (39%)
C2H2 Zn finger 554..571 CDD:275368 6/16 (38%)
CG14710NP_650092.4 zf-AD 9..83 CDD:285071
COG5048 <261..395 CDD:227381 43/158 (27%)
C2H2 Zn finger 264..284 CDD:275368 5/19 (26%)
zf-C2H2 290..312 CDD:278523 6/21 (29%)
C2H2 Zn finger 292..312 CDD:275368 6/19 (32%)
zf-H2C2_2 304..327 CDD:290200 5/22 (23%)
C2H2 Zn finger 320..340 CDD:275368 5/19 (26%)
zf-H2C2_2 335..357 CDD:290200 12/21 (57%)
C2H2 Zn finger 348..368 CDD:275368 7/19 (37%)
C2H2 Zn finger 376..395 CDD:275368 8/18 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23226
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.