DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12605 and CG4820

DIOPT Version :9

Sequence 1:NP_001261387.1 Gene:CG12605 / 38468 FlyBaseID:FBgn0035481 Length:619 Species:Drosophila melanogaster
Sequence 2:NP_001097748.1 Gene:CG4820 / 41344 FlyBaseID:FBgn0037876 Length:362 Species:Drosophila melanogaster


Alignment Length:264 Identity:62/264 - (23%)
Similarity:95/264 - (35%) Gaps:51/264 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   345 LQQWGKPNPQQNQQRASALKMCLNMLDGRTKASKAAAVTKQDRQEPMQPRPKSAQSNASSGGGPP 409
            :||...|:|....:..||..:            |...:..|..::|..|.|::....|.|.|..|
  Fly    96 VQQAAAPDPLGIDELMSASDI------------KIEPIQLQMEEDPQAPYPENQLEQALSYGNAP 148

  Fly   410 SEP----PENPAASLGHSSSGNGENYAKRKRGCYKCCECGKQYATSSNLSR---------HKQTH 461
            .|.    ||:...:....::...|...:|.:...|.    |....:..:.|         .||..
  Fly   149 GEDILPLPEDYGEAQTEVATTTNEPAQRRSKNTAKI----KSKKHTMRVGRKLIHVKVIDDKQPK 209

  Fly   462 RSLD--SQSAKK--CNTCGKAYVSMPALAMHLLTH--KLSHSCDICGKLFSRPWLLQGHLRSHTG 520
            |.:|  ..|||.  |..||:.:.....|.:|||.|  .....||.|.:......||:.|...|| 
  Fly   210 RIVDRNGPSAKPCICEHCGRQFKDTSNLHVHLLRHTGTKPFECDQCHQKCYTLHLLRRHQLKHT- 273

  Fly   521 EKPYACVHCGKAFADRSNLRAHMQ---------------THSGDKNFKCHRCNKTFALKSYLNKH 570
            |.||||..||..::..|:...|.:               ...|::.|.|..|:..|.......:|
  Fly   274 EGPYACTFCGLEYSTNSSRVRHEREACKKGRAPQSKWEIIKKGERTFHCEVCDLWFLRAGNFTQH 338

  Fly   571 LESA 574
            :.|:
  Fly   339 INSS 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12605NP_001261387.1 zf-C2H2 439..461 CDD:278523 5/30 (17%)
C2H2 Zn finger 441..461 CDD:275370 4/28 (14%)
C2H2 Zn finger 472..492 CDD:275368 7/19 (37%)
COG5048 492..>570 CDD:227381 23/94 (24%)
zf-C2H2 496..518 CDD:278523 6/21 (29%)
C2H2 Zn finger 498..518 CDD:275368 6/19 (32%)
zf-H2C2_2 511..534 CDD:290200 11/22 (50%)
zf-C2H2 524..546 CDD:278523 7/36 (19%)
C2H2 Zn finger 526..546 CDD:275368 5/34 (15%)
zf-H2C2_2 538..562 CDD:290200 5/38 (13%)
C2H2 Zn finger 554..571 CDD:275368 3/16 (19%)
CG4820NP_001097748.1 zf-AD 4..75 CDD:285071
C2H2 Zn finger 224..244 CDD:275368 7/19 (37%)
C2H2 Zn finger 252..272 CDD:275368 6/19 (32%)
C2H2 Zn finger 279..297 CDD:275368 5/17 (29%)
C2H2 Zn finger 322..339 CDD:275368 3/16 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457092
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.