DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12605 and zbtb14

DIOPT Version :9

Sequence 1:NP_001261387.1 Gene:CG12605 / 38468 FlyBaseID:FBgn0035481 Length:619 Species:Drosophila melanogaster
Sequence 2:NP_998701.1 Gene:zbtb14 / 406857 ZFINID:ZDB-GENE-040426-2946 Length:442 Species:Danio rerio


Alignment Length:309 Identity:76/309 - (24%)
Similarity:125/309 - (40%) Gaps:71/309 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   321 PLTPPNSDHSSDVDI--DMSSSSESGLQQWGKPNPQQNQQRASALKMCLNMLDGRTKASKAAAVT 383
            |:..|..:...||.:  |...:....:.:..:.|.:.::...:||::             ..|:.
Zfish   148 PMEDPPLNQDGDVQVLGDQDDTPSDDIVEEAQGNHELDKSPNNALQV-------------QEAIL 199

  Fly   384 KQDRQEPM---------------QPRPKSAQSNA-----SSGGGPPSEPPENPAAS--------- 419
            |:..||.:               :|:..:|.:..     |.|....::||....|:         
Zfish   200 KELAQEDVPKVGCYDQEVEALDGEPKELAAHTQTLSFADSMGDVKDTQPPGWSTATADMKFEYLL 264

  Fly   420 LGHSSSGNGENYAKRKRGCYKCCECGKQYATSSNLSRHKQTHRSLDSQSAKK---CNTCGKAYVS 481
            .||             |....|..|||.:...:.|.:|::.|      ||.:   |..|.||:.:
Zfish   265 YGH-------------RDQLACQVCGKTFIDENRLRKHEKLH------SADRPFICEICSKAFTT 310

  Fly   482 MPALAMHLLTHK--LSHSCDICGKLFSRPWLLQGHLRSHTGEKPYACVHCGKAFADRSNLRAHMQ 544
            ...|..||..|.  ..:.|:.|||.|.|...|:.|.|.|:.|:|:||..|.|||..:|:|:.|.:
Zfish   311 QAHLKEHLKIHTGFKPYRCEACGKSFIRAPDLKKHERVHSNERPFACQMCEKAFKHKSHLKDHER 375

  Fly   545 THSGDKNFKCHRCNKTFALKSYLNKHLESACLRDAGAIDQGKGLEEEDD 593
            .|.|:|.|.|:.|.|.||..|.|.:|..:  :.....: .|.||:.|.:
Zfish   376 RHRGEKPFVCNSCTKAFAKASDLKRHENN--MHSERKL-SGSGLQSETE 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12605NP_001261387.1 zf-C2H2 439..461 CDD:278523 6/21 (29%)
C2H2 Zn finger 441..461 CDD:275370 6/19 (32%)
C2H2 Zn finger 472..492 CDD:275368 7/19 (37%)
COG5048 492..>570 CDD:227381 33/79 (42%)
zf-C2H2 496..518 CDD:278523 9/21 (43%)
C2H2 Zn finger 498..518 CDD:275368 9/19 (47%)
zf-H2C2_2 511..534 CDD:290200 11/22 (50%)
zf-C2H2 524..546 CDD:278523 9/21 (43%)
C2H2 Zn finger 526..546 CDD:275368 8/19 (42%)
zf-H2C2_2 538..562 CDD:290200 9/23 (39%)
C2H2 Zn finger 554..571 CDD:275368 7/16 (44%)
zbtb14NP_998701.1 BTB 20..123 CDD:279045
BTB 31..122 CDD:197585
COG5048 <273..408 CDD:227381 50/142 (35%)
C2H2 Zn finger 273..293 CDD:275368 6/19 (32%)
zf-H2C2_2 286..310 CDD:290200 9/29 (31%)
zf-C2H2 299..321 CDD:278523 7/21 (33%)
C2H2 Zn finger 301..321 CDD:275368 7/19 (37%)
zf-H2C2_2 313..338 CDD:290200 9/24 (38%)
C2H2 Zn finger 329..349 CDD:275368 9/19 (47%)
zf-H2C2_2 341..366 CDD:290200 12/24 (50%)
C2H2 Zn finger 357..377 CDD:275368 8/19 (42%)
zf-H2C2_2 369..393 CDD:290200 9/23 (39%)
C2H2 Zn finger 385..401 CDD:275368 7/15 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.