Sequence 1: | NP_001261387.1 | Gene: | CG12605 / 38468 | FlyBaseID: | FBgn0035481 | Length: | 619 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_998701.1 | Gene: | zbtb14 / 406857 | ZFINID: | ZDB-GENE-040426-2946 | Length: | 442 | Species: | Danio rerio |
Alignment Length: | 309 | Identity: | 76/309 - (24%) |
---|---|---|---|
Similarity: | 125/309 - (40%) | Gaps: | 71/309 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 321 PLTPPNSDHSSDVDI--DMSSSSESGLQQWGKPNPQQNQQRASALKMCLNMLDGRTKASKAAAVT 383
Fly 384 KQDRQEPM---------------QPRPKSAQSNA-----SSGGGPPSEPPENPAAS--------- 419
Fly 420 LGHSSSGNGENYAKRKRGCYKCCECGKQYATSSNLSRHKQTHRSLDSQSAKK---CNTCGKAYVS 481
Fly 482 MPALAMHLLTHK--LSHSCDICGKLFSRPWLLQGHLRSHTGEKPYACVHCGKAFADRSNLRAHMQ 544
Fly 545 THSGDKNFKCHRCNKTFALKSYLNKHLESACLRDAGAIDQGKGLEEEDD 593 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG12605 | NP_001261387.1 | zf-C2H2 | 439..461 | CDD:278523 | 6/21 (29%) |
C2H2 Zn finger | 441..461 | CDD:275370 | 6/19 (32%) | ||
C2H2 Zn finger | 472..492 | CDD:275368 | 7/19 (37%) | ||
COG5048 | 492..>570 | CDD:227381 | 33/79 (42%) | ||
zf-C2H2 | 496..518 | CDD:278523 | 9/21 (43%) | ||
C2H2 Zn finger | 498..518 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 511..534 | CDD:290200 | 11/22 (50%) | ||
zf-C2H2 | 524..546 | CDD:278523 | 9/21 (43%) | ||
C2H2 Zn finger | 526..546 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 538..562 | CDD:290200 | 9/23 (39%) | ||
C2H2 Zn finger | 554..571 | CDD:275368 | 7/16 (44%) | ||
zbtb14 | NP_998701.1 | BTB | 20..123 | CDD:279045 | |
BTB | 31..122 | CDD:197585 | |||
COG5048 | <273..408 | CDD:227381 | 50/142 (35%) | ||
C2H2 Zn finger | 273..293 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 286..310 | CDD:290200 | 9/29 (31%) | ||
zf-C2H2 | 299..321 | CDD:278523 | 7/21 (33%) | ||
C2H2 Zn finger | 301..321 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 313..338 | CDD:290200 | 9/24 (38%) | ||
C2H2 Zn finger | 329..349 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 341..366 | CDD:290200 | 12/24 (50%) | ||
C2H2 Zn finger | 357..377 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 369..393 | CDD:290200 | 9/23 (39%) | ||
C2H2 Zn finger | 385..401 | CDD:275368 | 7/15 (47%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |