DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12605 and snai2

DIOPT Version :9

Sequence 1:NP_001261387.1 Gene:CG12605 / 38468 FlyBaseID:FBgn0035481 Length:619 Species:Drosophila melanogaster
Sequence 2:NP_989424.1 Gene:snai2 / 395065 XenbaseID:XB-GENE-487371 Length:266 Species:Xenopus tropicalis


Alignment Length:198 Identity:93/198 - (46%)
Similarity:118/198 - (59%) Gaps:12/198 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   390 PMQPRPKSAQSNASSGGGPPSEPPENPAASLGHSSS----GNGENYAKRKRG--------CYKCC 442
            |..|...|..|...|..|..|.||::..:|..||.|    .:.|...:.|..        .::|.
 Frog    65 PPLPSDLSPLSGYPSSLGRVSPPPQSDTSSKDHSGSESPISDEEERLQTKLSDSHAIEAEKFQCS 129

  Fly   443 ECGKQYATSSNLSRHKQTHRSLDSQSAKKCNTCGKAYVSMPALAMHLLTHKLSHSCDICGKLFSR 507
            .|.|.|:|.|.|::|||.|....|:.:..|..|.|.|||:.||.||:.||.|...|.||||.|||
 Frog   130 LCSKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCEKEYVSLGALKMHIRTHTLPCVCKICGKAFSR 194

  Fly   508 PWLLQGHLRSHTGEKPYACVHCGKAFADRSNLRAHMQTHSGDKNFKCHRCNKTFALKSYLNKHLE 572
            |||||||:|:||||||::|.||.:|||||||||||:||||..|.::|..|:|||:..|.|:||.|
 Frog   195 PWLLQGHIRTHTGEKPFSCPHCNRAFADRSNLRAHLQTHSDVKKYQCKNCSKTFSRMSLLHKHEE 259

  Fly   573 SAC 575
            |.|
 Frog   260 SGC 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12605NP_001261387.1 zf-C2H2 439..461 CDD:278523 10/21 (48%)
C2H2 Zn finger 441..461 CDD:275370 10/19 (53%)
C2H2 Zn finger 472..492 CDD:275368 10/19 (53%)
COG5048 492..>570 CDD:227381 50/77 (65%)
zf-C2H2 496..518 CDD:278523 16/21 (76%)
C2H2 Zn finger 498..518 CDD:275368 16/19 (84%)
zf-H2C2_2 511..534 CDD:290200 15/22 (68%)
zf-C2H2 524..546 CDD:278523 15/21 (71%)
C2H2 Zn finger 526..546 CDD:275368 15/19 (79%)
zf-H2C2_2 538..562 CDD:290200 14/23 (61%)
C2H2 Zn finger 554..571 CDD:275368 8/16 (50%)
snai2NP_989424.1 DUF4764 82..>160 CDD:292583 22/77 (29%)
C2H2 Zn finger 128..148 CDD:275370 10/19 (53%)
C2H2 Zn finger 159..179 CDD:275368 10/19 (53%)
C2H2 Zn finger 185..205 CDD:275368 16/19 (84%)
zf-H2C2_2 198..221 CDD:290200 15/22 (68%)
zf-C2H2 211..233 CDD:278523 15/21 (71%)
C2H2 Zn finger 213..233 CDD:275368 15/19 (79%)
zf-H2C2_2 225..250 CDD:290200 15/24 (63%)
C2H2 Zn finger 241..257 CDD:275368 7/15 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.