DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12605 and Slc45-1

DIOPT Version :9

Sequence 1:NP_001261387.1 Gene:CG12605 / 38468 FlyBaseID:FBgn0035481 Length:619 Species:Drosophila melanogaster
Sequence 2:NP_001261618.1 Gene:Slc45-1 / 39055 FlyBaseID:FBgn0035968 Length:599 Species:Drosophila melanogaster


Alignment Length:235 Identity:49/235 - (20%)
Similarity:79/235 - (33%) Gaps:73/235 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 APPASASGSPRQPEPVALKRERERDKEREREKE-----RERDRMREQQLVA-------ATAAASI 236
            |..|:...|.|.|....:.:.|| :..||::::     |.:.|....:|.|       |.||.:.
  Fly     8 ASQANQLSSVRNPMIKYMLKTRE-NHAREQDRDYSHVFRRKTRFEMFRLSAIAMAIEFAYAAETS 71

  Fly   237 YRGRSVEETEAAHDLLSLSQSLPPLI----PPCVVTIMKQEQEQL----RSPEIQEIS------- 286
            :....:.:....|..:|::..|.|||    .|.:.:|  .::.:|    |.|.|..:|       
  Fly    72 FVSPILLQIGVDHKHMSMTWGLSPLIGFFMSPLLGSI--SDRCKLRWGRRRPIISILSFGIMCGL 134

  Fly   287 -------------NSASSRSPQSTIRFIGSSSYDLMGGSSEGANNCSPLTPPN-SDHSSDV---- 333
                         ..|.....:|.:.|..||     |||.....:....|.|: ||:...|    
  Fly   135 ILVPYGKDLGLLLGDAGYTYAESALNFTSSS-----GGSVAALVSGEATTGPSASDYKFAVILTI 194

  Fly   334 ------DIDMSSSSESGLQQWGKPNPQQNQQRASALKMCL 367
                  |.|..:.              |...|...|.||:
  Fly   195 LGMVLLDFDADTC--------------QTPARTYLLDMCV 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12605NP_001261387.1 zf-C2H2 439..461 CDD:278523
C2H2 Zn finger 441..461 CDD:275370
C2H2 Zn finger 472..492 CDD:275368
COG5048 492..>570 CDD:227381
zf-C2H2 496..518 CDD:278523
C2H2 Zn finger 498..518 CDD:275368
zf-H2C2_2 511..534 CDD:290200
zf-C2H2 524..546 CDD:278523
C2H2 Zn finger 526..546 CDD:275368
zf-H2C2_2 538..562 CDD:290200
C2H2 Zn finger 554..571 CDD:275368
Slc45-1NP_001261618.1 GPH_sucrose 49..568 CDD:273545 39/193 (20%)
MFS 444..>597 CDD:119392
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.