DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12605 and Zbtb42

DIOPT Version :9

Sequence 1:NP_001261387.1 Gene:CG12605 / 38468 FlyBaseID:FBgn0035481 Length:619 Species:Drosophila melanogaster
Sequence 2:NP_001093930.1 Gene:Zbtb42 / 382639 MGIID:3644133 Length:420 Species:Mus musculus


Alignment Length:403 Identity:97/403 - (24%)
Similarity:142/403 - (35%) Gaps:106/403 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 RDRMREQQLVAATAAAS-----IYRGR------SVEETEAAHDLLSLSQSLPPLIPPCVVTIMKQ 272
            ||.:|....:....|.|     :|.||      .||:..||...|.:            ..|:|.
Mouse    61 RDTVRLNGDIVTVPAFSRLLDFMYEGRLDLHNLPVEDVLAAASYLHM------------YDIVKV 113

  Fly   273 EQEQLRSPEIQEISNSASSRSPQSTIRFIGSSSYDLMGGSSEGANNCSPL---TPPNSDHSSDVD 334
            .:.:||            .:.|....|.:|:   :|.|.......:.||.   ..|.:.|.|   
Mouse   114 CKGRLR------------KKDPDLETRTLGT---ELPGQPPHPLPSWSPAFCQAAPKAKHPS--- 160

  Fly   335 IDMSSSSESGLQQWGKPNPQQNQQRASALKMCLNMLDG--------RTKASKAAAVTKQDRQEPM 391
              :...:...|..:|.|:.|..:|.:.||.:.|.....        |.:.|..::|     |:..
Mouse   161 --LGVKATHPLPTFGPPSWQVAEQSSGALDLSLKPSPRPEQVHPPCRLQTSLCSSV-----QQVA 218

  Fly   392 QPRPK------SAQSNASSGGGPPSEPPENPAASLG--------HSSSGNGENYAKRKRGCYKCC 442
            ||..|      |.|.::|......|.||...:|:.|        |......:.............
Mouse   219 QPLVKAEQDSFSEQDSSSPQSADRSPPPVCASAAQGLAVDLEPLHIEGTGSQQLGLPAEPVLDSE 283

  Fly   443 ECGKQYATSSNLSRHKQTHRSLDSQSAKKCNTCGKAYVSMPALAMHLLTH---------KLS--- 495
            |.|.        |||...           |..|.|.:.|..||.:||..|         :||   
Mouse   284 ELGP--------SRHLCI-----------CPLCCKLFPSTHALQLHLSAHFRERDSVRARLSPEG 329

  Fly   496 --HSCDICGKLFSRPWLLQGHLRSHTGEKPYACVHCGKAFADRSNLRAHMQTHSGDKNFKCHRCN 558
              .:|.:|.|.||..:.|:.|.|:|:|||||.||.|||:|....||..|...|:.:|...|..|.
Mouse   330 SVPTCPLCSKTFSCTYTLKRHERTHSGEKPYTCVQCGKSFQYSHNLSRHAVVHTREKPHACRWCE 394

  Fly   559 KTFALKSYLNKHL 571
            :.|.....|.:|:
Mouse   395 RRFTQSGDLYRHV 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12605NP_001261387.1 zf-C2H2 439..461 CDD:278523 5/21 (24%)
C2H2 Zn finger 441..461 CDD:275370 5/19 (26%)
C2H2 Zn finger 472..492 CDD:275368 8/19 (42%)
COG5048 492..>570 CDD:227381 32/91 (35%)
zf-C2H2 496..518 CDD:278523 8/21 (38%)
C2H2 Zn finger 498..518 CDD:275368 8/19 (42%)
zf-H2C2_2 511..534 CDD:290200 14/22 (64%)
zf-C2H2 524..546 CDD:278523 10/21 (48%)
C2H2 Zn finger 526..546 CDD:275368 9/19 (47%)
zf-H2C2_2 538..562 CDD:290200 7/23 (30%)
C2H2 Zn finger 554..571 CDD:275368 4/16 (25%)
Zbtb42NP_001093930.1 BTB 14..114 CDD:279045 15/64 (23%)
BTB 25..121 CDD:197585 17/83 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 127..204 17/84 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 222..247 6/24 (25%)
C2H2 Zn finger 294..314 CDD:275368 8/19 (42%)
COG5048 334..>388 CDD:227381 25/53 (47%)
C2H2 Zn finger 334..354 CDD:275368 8/19 (42%)
zf-H2C2_2 347..369 CDD:290200 14/21 (67%)
C2H2 Zn finger 362..382 CDD:275368 9/19 (47%)
C2H2 Zn finger 390..408 CDD:275368 5/18 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.