DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12605 and CG11906

DIOPT Version :9

Sequence 1:NP_001261387.1 Gene:CG12605 / 38468 FlyBaseID:FBgn0035481 Length:619 Species:Drosophila melanogaster
Sequence 2:NP_611402.2 Gene:CG11906 / 37209 FlyBaseID:FBgn0034425 Length:634 Species:Drosophila melanogaster


Alignment Length:655 Identity:119/655 - (18%)
Similarity:195/655 - (29%) Gaps:237/655 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 LQSWRRPKPRTSG-----KVKFDDKSPLTASSV-------LKNANGNGLGTGGKSPLKSLAKRNS 98
            :|....|.|..|.     .|:.|::.....:.|       ..:||....|....|.|..|   .|
  Fly     1 MQDATAPDPEPSSTNGNCSVEHDNRQDQDENHVGAEREAEANDANCTVCGAAKASALLDL---RS 62

  Fly    99 RSILKREIIDLDDEDGEEQEDQLCEHLEWSAAQSLVQMN-------SSKQEKQR--RAG------ 148
            ..:::|.:    ..|.:...|.:...|:....:.:.::|       |..|..||  |:|      
  Fly    63 NHVMQRRL----SRDWKIHADVIRSTLKAICVECVCKLNMHSEVTRSLMQRMQRLQRSGGETTKV 123

  Fly   149 --TTGSPATVAAPVSASVSLRRPVGRAPAEDGKVIFYAPPASASGS---------PRQPEPVALK 202
              ||.||:..:.|::.:     .|.....|..:.:.::..:..|.|         .:||...:.|
  Fly   124 TTTTTSPSQHSPPIADA-----EVSTTLIESQEEVAHSGQSVRSRSSCSVLEVYLAQQPYSPSAK 183

  Fly   203 RERERDKE-------------------------------REREKERERDRMR----------EQQ 226
            ...|:..|                               :.|.|:....|::          |:.
  Fly   184 ETEEKHAEGWKWRTRLECHECGRAYFRRDYYAQHLRRCSKTRRKQPRPSRVKCRVLNEASYDEEA 248

  Fly   227 LVAATAAASIYRGRSVE---ET---EAAHDLLSLSQSLPPLIPPCVV---------------TIM 270
            ...|..::.||..|..:   ||   :..|:.:...|..     ||.:               ||.
  Fly   249 PSRAIRSSRIYYCRHCDAEFETLISKRQHERMKHQQRY-----PCDLCEAQLDTKYEWEMHHTIC 308

  Fly   271 KQEQEQLRSPEIQEISNSA-SSRSPQSTIRFIGSSSYDLMGGSSEGANNCSPLTPPNSDHSSDVD 334
            :.:||.|...|.||...:. :||.|::                      ||              
  Fly   309 QAKQEALAIVEQQEAGQTVMTSRVPRA----------------------CS-------------- 337

  Fly   335 IDMSSSSESGLQQWGKPNPQQNQQRASALKMCLNMLDGRTKASKAAAVTKQDRQEPMQPRPKSAQ 399
              |.|.|.:..:.|                                     ||.: |....:..:
  Fly   338 --MRSRSRACSEAW-------------------------------------DRYD-MDEEEEDEE 362

  Fly   400 SNASSGGGPPSEPPENPAASLGHSSSGNGENYAKRKR--GCYKCCECGKQYATSSNLS------R 456
            ......||...|..|..|.            ||:|..  |.:..........::.|||      .
  Fly   363 DEEIESGGEELEEGEEDAM------------YARRMNFTGDWIVNHSRSNSNSAGNLSLLYGDYG 415

  Fly   457 HKQTHRSLDSQ---------------SAKKCNT--CGKAYVSMPALAMH-LLTH-KLS-HSCDIC 501
            ..:||.:.|.:               .:..|.|  ||....::.||..| .:.| |:| ..|..|
  Fly   416 MVETHMTTDKEYDLYLLDLLKTQVRLKSFTCFTPDCGYQTDTLVALMKHDYMEHWKMSWFYCHKC 480

  Fly   502 GKLFSRPWLLQGHLRSHTGEKP-YACVHCGKAFADRSNLRAHMQTHSGDKNFKCHRCNKTFALKS 565
            |.:|:....|..|:  |...:. |.|..|.:.|..:..|..|.|.|....|:.|:.|...|..::
  Fly   481 GDVFTSKVFLDYHM--HLQNRGLYICHKCREEFELQHQLDRHFQLHRKGINYHCNFCRLEFLSEA 543

  Fly   566 YLNKH 570
            .|..|
  Fly   544 KLLAH 548

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12605NP_001261387.1 zf-C2H2 439..461 CDD:278523 3/27 (11%)
C2H2 Zn finger 441..461 CDD:275370 3/25 (12%)
C2H2 Zn finger 472..492 CDD:275368 7/22 (32%)
COG5048 492..>570 CDD:227381 23/80 (29%)
zf-C2H2 496..518 CDD:278523 6/21 (29%)
C2H2 Zn finger 498..518 CDD:275368 6/19 (32%)
zf-H2C2_2 511..534 CDD:290200 6/23 (26%)
zf-C2H2 524..546 CDD:278523 7/21 (33%)
C2H2 Zn finger 526..546 CDD:275368 6/19 (32%)
zf-H2C2_2 538..562 CDD:290200 7/23 (30%)
C2H2 Zn finger 554..571 CDD:275368 5/17 (29%)
CG11906NP_611402.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457104
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.