DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12605 and Bcl6b

DIOPT Version :9

Sequence 1:NP_001261387.1 Gene:CG12605 / 38468 FlyBaseID:FBgn0035481 Length:619 Species:Drosophila melanogaster
Sequence 2:NP_001101749.1 Gene:Bcl6b / 360551 RGDID:1563179 Length:472 Species:Rattus norvegicus


Alignment Length:417 Identity:105/417 - (25%)
Similarity:159/417 - (38%) Gaps:109/417 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 SIYRGRSVEETEAAHDLLSL-----SQSLPPLIPPCVVTIMKQEQEQLRSPEIQEISNSAS---- 290
            ||:|||:    ....|:|||     ::...||:     ..|...:.:|.......:..:|:    
  Rat    65 SIFRGRA----GVGVDVLSLPGGPEARGFAPLL-----DFMYTSRLRLSPATAPAVLAAATYLQM 120

  Fly   291 SRSPQSTIRFIGSSSYDLMGGSSEGANNCSP----LTPPNSDHSSDVDIDMSSSSESGLQQWGKP 351
            ....|:..||| .:||:.:|.|........|    :.||.|...|:...|..:.|.|..|  |.|
  Rat   121 EHVVQACHRFI-QASYEPLGISLRPMEAEPPRPPTVPPPGSPRRSEGHPDPPTESRSCSQ--GSP 182

  Fly   352 NPQQNQQRASALK----MCLNMLDGRTKASKAAAVTKQDRQEPMQPRPK---------SAQSNAS 403
            :|.....:|...|    :.||     :::|:|.::..:...:|. |:.:         |:.|::|
  Rat   183 SPASPDPKACNWKKYKFIVLN-----SQSSQAGSLAGESSGQPC-PQARLPSGDEACSSSSSSSS 241

  Fly   404 SGGGPPS--------------------------EPPENPAASLGHSSSG-------NGENYAKRK 435
            ..|..|.                          .||....:...|...|       |.|..|   
  Rat   242 EEGATPGLQSRLSLATTTARFKCGALANNSYLFTPPAQETSKQAHPPPGSECLSCQNCEAVA--- 303

  Fly   436 RGC---------------YKCCECGKQYATSSNLSRHKQTHRSLDSQSAKKCNTCGKAYVSMPAL 485
             ||               |||..|...:....||:.|:..|   ..:...:|:.|| |..:.|| 
  Rat   304 -GCSSGIEPLAPGDEDKPYKCQLCRSAFRYKGNLASHRTVH---TGEKPYRCSVCG-ARFNRPA- 362

  Fly   486 AMHLLTHKLSHS------CDICGKLFSRPWLLQGHLRSHTGEKPYACVHCGKAFADRSNLRAHMQ 544
              :|.||...||      |:.||..|.:...|:.|:..|||||||.|..||..|.....|::|::
  Rat   363 --NLKTHSRIHSGEKPYKCETCGSRFVQVAHLRAHVLIHTGEKPYPCPTCGTRFRHLQTLKSHVR 425

  Fly   545 THSGDKNFKCHRCNKTFALKSYLNKHL 571
            .|:|:|.:.|..|...|..||.|..||
  Rat   426 IHTGEKPYHCDPCGLHFRHKSQLRLHL 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12605NP_001261387.1 zf-C2H2 439..461 CDD:278523 7/21 (33%)
C2H2 Zn finger 441..461 CDD:275370 5/19 (26%)
C2H2 Zn finger 472..492 CDD:275368 7/19 (37%)
COG5048 492..>570 CDD:227381 31/83 (37%)
zf-C2H2 496..518 CDD:278523 8/27 (30%)
C2H2 Zn finger 498..518 CDD:275368 6/19 (32%)
zf-H2C2_2 511..534 CDD:290200 12/22 (55%)
zf-C2H2 524..546 CDD:278523 7/21 (33%)
C2H2 Zn finger 526..546 CDD:275368 6/19 (32%)
zf-H2C2_2 538..562 CDD:290200 7/23 (30%)
C2H2 Zn finger 554..571 CDD:275368 6/16 (38%)
Bcl6bNP_001101749.1 BTB 28..132 CDD:279045 18/76 (24%)
BTB 39..131 CDD:197585 16/74 (22%)
C2H2 Zn finger 323..343 CDD:275368 5/19 (26%)
zf-H2C2_2 335..360 CDD:290200 8/28 (29%)
C2H2 Zn finger 351..371 CDD:275368 9/23 (39%)
zf-H2C2_2 363..388 CDD:290200 9/24 (38%)
C2H2 Zn finger 379..399 CDD:275368 6/19 (32%)
zf-H2C2_2 391..416 CDD:290200 13/24 (54%)
C2H2 Zn finger 407..427 CDD:275368 6/19 (32%)
zf-H2C2_2 420..444 CDD:290200 8/23 (35%)
C2H2 Zn finger 435..453 CDD:275368 8/18 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.