DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG12605 and CG1603

DIOPT Version :9

Sequence 1:	NP_001261387.1	Gene:	CG12605 / 38468	FlyBaseID:	FBgn0035481	Length:	619	Species:	Drosophila melanogaster
Sequence 2:	NP_001260778.1	Gene:	CG1603 / 35683	FlyBaseID:	FBgn0033185	Length:	586	Species:	Drosophila melanogaster

Alignment Length:	141	Identity:	47/141 - (33%)
Similarity:	69/141 - (48%)	Gaps:	12/141 - (8%)

- Green bases have known domain annotations that are detailed below.

  Fly   439 YKCCECGKQYATSSNLSRHK-QTH--RSLDSQSAKKCNTCGKAYVSMPALAMHLLTH--KLSHSC 498
            |.|..|.:::....::.||| ::|  |.|      ||..|.|::.....|.:|.|.|  :..|.|
  Fly   448 YLCSFCPRRFDRHVDMDRHKLRSHFERKL------KCQYCEKSFAVDTDLKVHTLIHTGERPHVC 506

  Fly   499 DICGKLFSRPWLLQGHLRS-HTGEKPYACVHCGKAFADRSNLRAHMQTHSGDKNFKCHRCNKTFA 562
            |||||.|....||..|:.. |...:||:|..|.|.|..:..|..|::.|...::.||..|:.||.
  Fly   507 DICGKTFRLKLLLDHHVNGVHLNIRPYSCNMCTKTFRKKFELANHIKGHLNIRDKKCEYCDATFY 571

  Fly   563 LKSYLNKHLES 573
            ..|.|::|..|
  Fly   572 DHSSLSRHRRS 582

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG12605	NP_001261387.1	zf-C2H2	439..461	CDD:278523	6/22 (27%)
		C2H2 Zn finger	441..461	CDD:275370	5/20 (25%)
		C2H2 Zn finger	472..492	CDD:275368	6/19 (32%)
		COG5048	492..>570	CDD:227381	29/80 (36%)
		zf-C2H2	496..518	CDD:278523	11/22 (50%)
		C2H2 Zn finger	498..518	CDD:275368	10/20 (50%)
		zf-H2C2_2	511..534	CDD:290200	8/23 (35%)
		zf-C2H2	524..546	CDD:278523	7/21 (33%)
		C2H2 Zn finger	526..546	CDD:275368	6/19 (32%)
		zf-H2C2_2	538..562	CDD:290200	7/23 (30%)
		C2H2 Zn finger	554..571	CDD:275368	6/16 (38%)
CG1603	NP_001260778.1	MADF_DNA_bdg	202..287	CDD:287510
		GT1	321..408	CDD:304916
		C2H2 Zn finger	420..441	CDD:275368
		COG5048	<424..583	CDD:227381	47/141 (33%)
		C2H2 Zn finger	450..471	CDD:275368	5/20 (25%)
		C2H2 Zn finger	478..498	CDD:275368	6/19 (32%)
		zf-H2C2_2	490..513	CDD:290200	11/22 (50%)
		C2H2 Zn finger	506..527	CDD:275368	10/20 (50%)
		C2H2 Zn finger	535..555	CDD:275368	6/19 (32%)
		C2H2 Zn finger	563..583	CDD:275368	8/20 (40%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C45457078
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	0.930