Sequence 1: | NP_001261387.1 | Gene: | CG12605 / 38468 | FlyBaseID: | FBgn0035481 | Length: | 619 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001138223.2 | Gene: | CG1529 / 33077 | FlyBaseID: | FBgn0031144 | Length: | 512 | Species: | Drosophila melanogaster |
Alignment Length: | 252 | Identity: | 63/252 - (25%) |
---|---|---|---|
Similarity: | 102/252 - (40%) | Gaps: | 38/252 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 333 VDIDMSSSSESGLQQWGKPNPQQNQQRASALKMCLNMLDGRTKASKAAAVTKQDRQEPMQPRPKS 397
Fly 398 AQSNASSGGGPPSEPPENPAASLGHSSSGNGENYAKRKRGCYKCCECGKQYATSSNLSRHKQTHR 462
Fly 463 SLDSQSAKK--CNTCGKAYVSMPALAMHL---------LTHKLSH-SCDICGKLFSRPWLLQGHL 515
Fly 516 RSHTGEKPYACVHCGKAFADRSNLRAHMQTHSGD-KNFKCHRCNKTFALKSYLNKHL 571 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG12605 | NP_001261387.1 | zf-C2H2 | 439..461 | CDD:278523 | 7/21 (33%) |
C2H2 Zn finger | 441..461 | CDD:275370 | 7/19 (37%) | ||
C2H2 Zn finger | 472..492 | CDD:275368 | 6/28 (21%) | ||
COG5048 | 492..>570 | CDD:227381 | 26/79 (33%) | ||
zf-C2H2 | 496..518 | CDD:278523 | 6/22 (27%) | ||
C2H2 Zn finger | 498..518 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 511..534 | CDD:290200 | 10/22 (45%) | ||
zf-C2H2 | 524..546 | CDD:278523 | 8/21 (38%) | ||
C2H2 Zn finger | 526..546 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 538..562 | CDD:290200 | 8/24 (33%) | ||
C2H2 Zn finger | 554..571 | CDD:275368 | 5/16 (31%) | ||
CG1529 | NP_001138223.2 | zf-AD | 11..79 | CDD:285071 | |
C2H2 Zn finger | 171..192 | CDD:275368 | 9/23 (39%) | ||
zf-C2H2_2 | 201..>257 | CDD:289522 | 13/55 (24%) | ||
C2H2 Zn finger | 201..222 | CDD:275368 | 5/20 (25%) | ||
C2H2 Zn finger | 237..257 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 265..285 | CDD:275368 | 8/19 (42%) | ||
zf-C2H2_8 | 268..349 | CDD:292531 | 16/44 (36%) | ||
C2H2 Zn finger | 294..315 | CDD:275368 | 6/18 (33%) | ||
C2H2 Zn finger | 323..343 | CDD:275368 | |||
C2H2 Zn finger | 360..380 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45457079 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |