Sequence 1: | NP_001261387.1 | Gene: | CG12605 / 38468 | FlyBaseID: | FBgn0035481 | Length: | 619 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001300628.1 | Gene: | snai1a / 30273 | ZFINID: | ZDB-GENE-990415-255 | Length: | 260 | Species: | Danio rerio |
Alignment Length: | 202 | Identity: | 79/202 - (39%) |
---|---|---|---|
Similarity: | 105/202 - (51%) | Gaps: | 29/202 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 383 TKQDRQEPMQPRPKSAQSNASSG---GGPPSEPPENPAASLGHSSSGNGENYAKRKRGCYKCCEC 444
Fly 445 GKQYATSSNLSRHKQTHRSLD------SQSAKKCNTCGKAYVSMPALAMHLLTHKLSHSCDICGK 503
Fly 504 LFSRPWLLQGHLRSHTGEKPYACVHCGKAFADRSNLRAHMQTHSGDKNFKCHRCNKTFALKSYLN 568
Fly 569 KHLESAC 575 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG12605 | NP_001261387.1 | zf-C2H2 | 439..461 | CDD:278523 | 5/21 (24%) |
C2H2 Zn finger | 441..461 | CDD:275370 | 5/19 (26%) | ||
C2H2 Zn finger | 472..492 | CDD:275368 | 9/19 (47%) | ||
COG5048 | 492..>570 | CDD:227381 | 45/77 (58%) | ||
zf-C2H2 | 496..518 | CDD:278523 | 14/21 (67%) | ||
C2H2 Zn finger | 498..518 | CDD:275368 | 14/19 (74%) | ||
zf-H2C2_2 | 511..534 | CDD:290200 | 13/22 (59%) | ||
zf-C2H2 | 524..546 | CDD:278523 | 15/21 (71%) | ||
C2H2 Zn finger | 526..546 | CDD:275368 | 15/19 (79%) | ||
zf-H2C2_2 | 538..562 | CDD:290200 | 12/23 (52%) | ||
C2H2 Zn finger | 554..571 | CDD:275368 | 7/16 (44%) | ||
snai1a | NP_001300628.1 | C2H2 Zn finger | 149..169 | CDD:275368 | 9/19 (47%) |
COG5048 | <170..>244 | CDD:227381 | 43/73 (59%) | ||
zf-C2H2 | 173..195 | CDD:278523 | 14/21 (67%) | ||
C2H2 Zn finger | 175..195 | CDD:275368 | 14/19 (74%) | ||
zf-H2C2_2 | 188..211 | CDD:290200 | 13/22 (59%) | ||
zf-C2H2 | 201..223 | CDD:278523 | 15/21 (71%) | ||
C2H2 Zn finger | 203..223 | CDD:275368 | 15/19 (79%) | ||
C2H2 Zn finger | 231..247 | CDD:275368 | 6/15 (40%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG2462 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |