DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12605 and snai1a

DIOPT Version :9

Sequence 1:NP_001261387.1 Gene:CG12605 / 38468 FlyBaseID:FBgn0035481 Length:619 Species:Drosophila melanogaster
Sequence 2:NP_001300628.1 Gene:snai1a / 30273 ZFINID:ZDB-GENE-990415-255 Length:260 Species:Danio rerio


Alignment Length:202 Identity:79/202 - (39%)
Similarity:105/202 - (51%) Gaps:29/202 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   383 TKQDRQEPMQPRPKSAQSNASSG---GGPPSEPPENPAASLGHSSSGNGENYAKRKRGCYKCCEC 444
            |....|.|:.....|:.|.:|||   .|..|:||...::...|...      ..|.|        
Zfish    71 TLSTNQGPLDLSSPSSISCSSSGEEDEGRTSDPPSPDSSDTYHPQQ------TSRPR-------- 121

  Fly   445 GKQYATSSNLSRHKQTHRSLD------SQSAKKCNTCGKAYVSMPALAMHLLTHKLSHSCDICGK 503
                  .||.||..|.....:      |:.|..|..|.|.|.|:.||.||:.:|.|...|..|||
Zfish   122 ------RSNKSRAGQREDKSEAAVTAASRPAFFCKHCPKEYNSLGALKMHIRSHTLPCVCPTCGK 180

  Fly   504 LFSRPWLLQGHLRSHTGEKPYACVHCGKAFADRSNLRAHMQTHSGDKNFKCHRCNKTFALKSYLN 568
            .|||||||:||:|:||||:|::|.||.:|||||||||||:|||:..|.::|..|::||:..|.|.
Zfish   181 AFSRPWLLRGHIRTHTGERPFSCPHCNRAFADRSNLRAHLQTHADVKKYQCSTCSRTFSRMSLLQ 245

  Fly   569 KHLESAC 575
            ||..:.|
Zfish   246 KHSAAGC 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12605NP_001261387.1 zf-C2H2 439..461 CDD:278523 5/21 (24%)
C2H2 Zn finger 441..461 CDD:275370 5/19 (26%)
C2H2 Zn finger 472..492 CDD:275368 9/19 (47%)
COG5048 492..>570 CDD:227381 45/77 (58%)
zf-C2H2 496..518 CDD:278523 14/21 (67%)
C2H2 Zn finger 498..518 CDD:275368 14/19 (74%)
zf-H2C2_2 511..534 CDD:290200 13/22 (59%)
zf-C2H2 524..546 CDD:278523 15/21 (71%)
C2H2 Zn finger 526..546 CDD:275368 15/19 (79%)
zf-H2C2_2 538..562 CDD:290200 12/23 (52%)
C2H2 Zn finger 554..571 CDD:275368 7/16 (44%)
snai1aNP_001300628.1 C2H2 Zn finger 149..169 CDD:275368 9/19 (47%)
COG5048 <170..>244 CDD:227381 43/73 (59%)
zf-C2H2 173..195 CDD:278523 14/21 (67%)
C2H2 Zn finger 175..195 CDD:275368 14/19 (74%)
zf-H2C2_2 188..211 CDD:290200 13/22 (59%)
zf-C2H2 201..223 CDD:278523 15/21 (71%)
C2H2 Zn finger 203..223 CDD:275368 15/19 (79%)
C2H2 Zn finger 231..247 CDD:275368 6/15 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2462
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.