Sequence 1: | NP_001261387.1 | Gene: | CG12605 / 38468 | FlyBaseID: | FBgn0035481 | Length: | 619 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_700447.2 | Gene: | Zbtb24 / 268294 | MGIID: | 3039618 | Length: | 710 | Species: | Mus musculus |
Alignment Length: | 396 | Identity: | 93/396 - (23%) |
---|---|---|---|
Similarity: | 145/396 - (36%) | Gaps: | 124/396 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 289 ASSRSPQ---STIRFIGSSSYDLMGGSSEGANNCSPLTPPNSDHSSDVDIDMSSSSESGL-QQWG 349
Fly 350 KP------------------------NPQQNQQRASALKMCLNMLDGRTKASKAAAVTKQDRQEP 390
Fly 391 MQPRPKSAQSNASSGGGPPSEPPEN--PAASLGHSSS--------------------GNGENYAK 433
Fly 434 RKRGC--------------------------------------YKCCECGKQYATSSNLSRHKQT 460
Fly 461 HRSLDSQSAKKCNTCGKAYVSMPALAMHLLTH--KLSHSCDICGKLFSRPWLLQGHLRSHTGEKP 523
Fly 524 YACVHCGKAFADRSNLRAHMQTHSGDKNFKCHRCNKTFALKSYLNKHLE-------------SAC 575
Fly 576 LRDAGA 581 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG12605 | NP_001261387.1 | zf-C2H2 | 439..461 | CDD:278523 | 9/21 (43%) |
C2H2 Zn finger | 441..461 | CDD:275370 | 8/19 (42%) | ||
C2H2 Zn finger | 472..492 | CDD:275368 | 7/19 (37%) | ||
COG5048 | 492..>570 | CDD:227381 | 35/79 (44%) | ||
zf-C2H2 | 496..518 | CDD:278523 | 10/21 (48%) | ||
C2H2 Zn finger | 498..518 | CDD:275368 | 10/19 (53%) | ||
zf-H2C2_2 | 511..534 | CDD:290200 | 9/22 (41%) | ||
zf-C2H2 | 524..546 | CDD:278523 | 8/21 (38%) | ||
C2H2 Zn finger | 526..546 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 538..562 | CDD:290200 | 10/23 (43%) | ||
C2H2 Zn finger | 554..571 | CDD:275368 | 7/16 (44%) | ||
Zbtb24 | NP_700447.2 | BTB | 27..128 | CDD:279045 | 7/28 (25%) |
BTB | 38..133 | CDD:197585 | 8/33 (24%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 134..176 | 6/41 (15%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 202..256 | 13/60 (22%) | |||
C2H2 Zn finger | 295..315 | CDD:275368 | 0/19 (0%) | ||
zf-H2C2_2 | 308..332 | CDD:290200 | 6/23 (26%) | ||
COG5048 | <320..479 | CDD:227381 | 56/159 (35%) | ||
C2H2 Zn finger | 323..343 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 335..360 | CDD:290200 | 8/27 (30%) | ||
C2H2 Zn finger | 351..371 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 363..388 | CDD:290200 | 10/24 (42%) | ||
C2H2 Zn finger | 379..399 | CDD:275368 | 10/19 (53%) | ||
COG5048 | 406..>563 | CDD:227381 | 24/70 (34%) | ||
C2H2 Zn finger | 407..427 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 420..443 | CDD:290200 | 10/22 (45%) | ||
C2H2 Zn finger | 435..455 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 447..471 | CDD:290200 | 3/23 (13%) | ||
C2H2 Zn finger | 463..479 | CDD:275368 | 3/13 (23%) | ||
zf-H2C2_2 | 477..500 | CDD:290200 | |||
C2H2 Zn finger | 491..511 | CDD:275368 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 651..676 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |