DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12605 and HIC2

DIOPT Version :9

Sequence 1:NP_001261387.1 Gene:CG12605 / 38468 FlyBaseID:FBgn0035481 Length:619 Species:Drosophila melanogaster
Sequence 2:NP_055909.2 Gene:HIC2 / 23119 HGNCID:18595 Length:615 Species:Homo sapiens


Alignment Length:397 Identity:107/397 - (26%)
Similarity:150/397 - (37%) Gaps:99/397 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 ETEAAHDLLSLSQSLPPLIPPCVVTIMKQEQEQLRSPEIQEISNSASSRSPQSTIRFIGSSSYDL 308
            |.|...||...|..|||..|...:|  ..:..||  .:.|..|..|:|..|.:     .|:||..
Human   242 EQELGLDLSKKSPPLPPATPGPHLT--PDDAAQL--SDSQHGSPPAASAPPVA-----NSASYSE 297

  Fly   309 MGGSS------EGA--NNCSPLTPPNSDHSSDVDIDMSSSSESGLQQWGKPNPQQN---QQRASA 362
            :||:.      |||  |:.|.|..|......      |....:..::|||..|...   ::|.:.
Human   298 LGGTPDEPMDLEGAEDNHLSLLEAPGGQPRK------SLRHSTRKKEWGKKEPVAGSPFERREAG 356

  Fly   363 LKMCLNMLDGRTKASKAAAVTKQDRQEPMQPRPKSAQSNASSGGGPPSEPP-------------- 413
            .|       |.....:...|  .||.      |....::.:...||..|||              
Human   357 PK-------GPCPGEEGEGV--GDRV------PNGILASGAGPSGPYGEPPYPCKEEEENGKDAS 406

  Fly   414 ENPAASLGHSSSGNGE-NYAKRKRG---------CYKCCECGKQYATSSNLSRHKQTH------- 461
            |:.|.|.....||:.. :|..|:.|         .|.|..|.|.:.:|..|:.|.:||       
Human   407 EDSAQSGSEGGSGHASAHYMYRQEGYETVSYGDNLYVCIPCAKGFPSSEQLNAHVETHTEEELFI 471

  Fly   462 -----------------RSLDSQSAK--------KCNTCGKAYVSMPALAMHLLTHKLSH--SCD 499
                             ..|.:.||.        ||:.|.|.|.....|..|..||.|:.  .|:
Human   472 KEEGAYETGSGGAEEEAEDLSAPSAAYTAEPRPFKCSVCEKTYKDPATLRQHEKTHWLTRPFPCN 536

  Fly   500 ICGKLFSRPWLLQGHLRSHTGEKPYACVHCGKAFADRSNLRAHMQTHSGDKNFKCHRCNKTFALK 564
            ||||:|::...:..|:|||.|.||:||..||..|..:..|..||:.|||:|.::|..|...|..:
Human   537 ICGKMFTQRGTMTRHMRSHLGLKPFACDECGMRFTRQYRLTEHMRVHSGEKPYECQLCGGKFTQQ 601

  Fly   565 SYLNKHL 571
            ..|..||
Human   602 RNLISHL 608

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12605NP_001261387.1 zf-C2H2 439..461 CDD:278523 7/21 (33%)
C2H2 Zn finger 441..461 CDD:275370 6/19 (32%)
C2H2 Zn finger 472..492 CDD:275368 6/19 (32%)
COG5048 492..>570 CDD:227381 31/79 (39%)
zf-C2H2 496..518 CDD:278523 8/23 (35%)
C2H2 Zn finger 498..518 CDD:275368 8/19 (42%)
zf-H2C2_2 511..534 CDD:290200 11/22 (50%)
zf-C2H2 524..546 CDD:278523 8/21 (38%)
C2H2 Zn finger 526..546 CDD:275368 7/19 (37%)
zf-H2C2_2 538..562 CDD:290200 9/23 (39%)
C2H2 Zn finger 554..571 CDD:275368 4/16 (25%)
HIC2NP_055909.2 BTB 40..140 CDD:279045
BTB 47..141 CDD:197585
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 144..167
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 182..208
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 229..421 51/208 (25%)
Binding to CtBP 246..250 1/3 (33%)
TMEM119 <300..395 CDD:292352 25/115 (22%)
C2H2 Zn finger 444..464 CDD:275368 6/19 (32%)
zf-C2H2 505..527 CDD:278523 7/21 (33%)
C2H2 Zn finger 507..527 CDD:275368 6/19 (32%)
zf-C2H2 533..555 CDD:278523 8/21 (38%)
C2H2 Zn finger 535..555 CDD:275368 8/19 (42%)
zf-H2C2_2 548..572 CDD:290200 12/23 (52%)
COG5048 559..>613 CDD:227381 20/50 (40%)
C2H2 Zn finger 563..583 CDD:275368 7/19 (37%)
zf-H2C2_2 576..600 CDD:290200 10/23 (43%)
C2H2 Zn finger 591..611 CDD:275368 6/18 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.