| Sequence 1: | NP_001261387.1 | Gene: | CG12605 / 38468 | FlyBaseID: | FBgn0035481 | Length: | 619 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001343211.1 | Gene: | Zbtb14 / 22666 | MGIID: | 1195345 | Length: | 449 | Species: | Mus musculus |
| Alignment Length: | 320 | Identity: | 77/320 - (24%) |
|---|---|---|---|
| Similarity: | 117/320 - (36%) | Gaps: | 97/320 - (30%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 332 DVDIDMSSSSESGLQQWGK----------PNPQQNQQRASALKMCLNMLDGRTKASKAAAVTKQD 386
Fly 387 RQEPMQPRPKSAQSNASSGGGPPSEPPENPAASLGHSSS-----GNGENYAKRKRGCY------- 439
Fly 440 ------------------------------------------------------KCCECGKQYAT 450
Fly 451 SSNLSRHKQTHRSLDSQSAKK---CNTCGKAYVSMPALAMHLLTHK--LSHSCDICGKLFSRPWL 510
Fly 511 LQGHLRSHTGEKPYACVHCGKAFADRSNLRAHMQTHSGDKNFKCHRCNKTFALKSYLNKH 570 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG12605 | NP_001261387.1 | zf-C2H2 | 439..461 | CDD:278523 | 7/82 (9%) |
| C2H2 Zn finger | 441..461 | CDD:275370 | 6/19 (32%) | ||
| C2H2 Zn finger | 472..492 | CDD:275368 | 6/19 (32%) | ||
| COG5048 | 492..>570 | CDD:227381 | 34/79 (43%) | ||
| zf-C2H2 | 496..518 | CDD:278523 | 10/21 (48%) | ||
| C2H2 Zn finger | 498..518 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 511..534 | CDD:290200 | 11/22 (50%) | ||
| zf-C2H2 | 524..546 | CDD:278523 | 9/21 (43%) | ||
| C2H2 Zn finger | 526..546 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 538..562 | CDD:290200 | 9/23 (39%) | ||
| C2H2 Zn finger | 554..571 | CDD:275368 | 8/17 (47%) | ||
| Zbtb14 | NP_001343211.1 | BTB_POZ_ZBTB14 | 18..131 | CDD:349513 | 7/26 (27%) |
| Nuclear localization signal. /evidence=ECO:0000255 | 50..66 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 156..194 | 8/37 (22%) | |||
| C2H2 Zn finger | 279..299 | CDD:275368 | 6/19 (32%) | ||
| SFP1 | <303..383 | CDD:227516 | 29/79 (37%) | ||
| C2H2 Zn finger | 307..327 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 319..344 | CDD:404364 | 10/24 (42%) | ||
| C2H2 Zn finger | 335..355 | CDD:275368 | 9/19 (47%) | ||
| C2H2 Zn finger | 363..383 | CDD:275368 | 8/19 (42%) | ||
| C2H2 Zn finger | 391..407 | CDD:275368 | 7/15 (47%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 405..424 | 1/3 (33%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||