DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12605 and Zbtb8b

DIOPT Version :9

Sequence 1:NP_001261387.1 Gene:CG12605 / 38468 FlyBaseID:FBgn0035481 Length:619 Species:Drosophila melanogaster
Sequence 2:XP_006502990.1 Gene:Zbtb8b / 215627 MGIID:2387181 Length:517 Species:Mus musculus


Alignment Length:557 Identity:107/557 - (19%)
Similarity:189/557 - (33%) Gaps:184/557 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 PVGRAPAEDGKVIFYAPPASASGSPRQPEPVALKRERERDKERERE------------------- 214
            |..|||...        .|:|:|...:.:....|...|.:::|:|:                   
Mouse    17 PGARAPGPS--------RAAAAGGEMEAQSYCAKLLGELNEQRKRDFFCDCSIIVEGRIFKAHRN 73

  Fly   215 -----------------KERERDRMREQQLVAATAAASI----YRGR------SVEETEAAHDLL 252
                             ::..|.......:|.:.|.::|    |.|:      :|.|..:|...|
Mouse    74 ILFANSGYFRALLLHYIQDSGRHSTASLDIVTSDAFSTILDFLYSGKLDLCGENVIEVMSAASYL 138

  Fly   253 SLSQSLPPLIPPCVVTI-------MKQEQEQLRSPEIQEISNSAS-------SRSPQSTIR--FI 301
            .:::    ::..|...|       .|.|:|...:..:...:.:|:       |.||.|.:.  ..
Mouse   139 QMNE----VVNFCKTYIRSSLDICRKMEKEAAVAAAMAAAAAAAAAAAHQIDSESPSSGLEGTSC 199

  Fly   302 GSSSYDLMGGSSEGANNCSPLTPPNSDHSSDVDIDMSSSSESGLQQWGKPNPQQNQQRASALKMC 366
            |:.|:.......||:.:|   |..:.|....:::....|..||:               |...:|
Mouse   200 GTKSFVSSPVDGEGSLDC---TISSCDDCHPLELVAKDSQGSGV---------------SDNDLC 246

  Fly   367 L--NMLDGRTKASKAAAVTKQDRQEPMQPRPKSAQSNASSGGGPPSEPPENPAASLGHSSSGNGE 429
            :  ..::.:.:...|....:.|.|......|.:......         |.|.|..|.::|     
Mouse   247 VVPRRVEPKVEFDVARVEVEADEQLQQYAAPLAHMEEGL---------PSNQALDLTYNS----- 297

  Fly   430 NYAKRKRGCYKCCECGKQYATSSNLSRHKQTHRSLDSQSAKKCNTCGKAYVSMPALAMH------ 488
                     |..    ||:..:...:...|:...||..|::..    :..:..|.:||.      
Mouse   298 ---------YHV----KQFLEALLRNGAVQSKDDLDCHSSRGL----EGRLEGPGVAMSSVMDVQ 345

  Fly   489 ------------LLTHKLSHSCDICGKLFSRPWLLQGHLRSHTGEKPYACVHCGKAFADRSNLRA 541
                        ::..|| |.|..|.....:..:|:.|:||||||:||.|..|||.|..:.:||:
Mouse   346 NDWYREDAGDVLVVPIKL-HRCPFCPYTAKQKGILKRHIRSHTGERPYPCETCGKRFTRQEHLRS 409

  Fly   542 H-MQTHSGDKNFKCHRCNKTFALKSYLNKHL-------ESACLRDAGAIDQGKGLEEEDD----- 593
            | :..|...:...|..|.:||.  |:|::.|       ...|:.|.        .|||||     
Mouse   410 HALSVHRSSRPIICKGCRRTFT--SHLSQGLRRFGLCDSCTCVTDP--------QEEEDDLMPVN 464

  Fly   594 -----------DCSKQDE----LEMGDELESDENSQD 615
                       :.|..|:    :|.|:  |:|..::|
Mouse   465 LSLVEASSESHEKSDTDDWPIYIESGE--ENDPTAED 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12605NP_001261387.1 zf-C2H2 439..461 CDD:278523 4/21 (19%)
C2H2 Zn finger 441..461 CDD:275370 3/19 (16%)
C2H2 Zn finger 472..492 CDD:275368 3/37 (8%)
COG5048 492..>570 CDD:227381 30/78 (38%)
zf-C2H2 496..518 CDD:278523 6/21 (29%)
C2H2 Zn finger 498..518 CDD:275368 5/19 (26%)
zf-H2C2_2 511..534 CDD:290200 14/22 (64%)
zf-C2H2 524..546 CDD:278523 9/22 (41%)
C2H2 Zn finger 526..546 CDD:275368 8/20 (40%)
zf-H2C2_2 538..562 CDD:290200 7/24 (29%)
C2H2 Zn finger 554..571 CDD:275368 6/16 (38%)
Zbtb8bXP_006502990.1 BTB_POZ_ZBTB8B 39..151 CDD:349639 15/115 (13%)
zf-H2C2_5 364..388 CDD:404746 8/23 (35%)
C2H2 Zn finger 366..386 CDD:275368 5/19 (26%)
zf-H2C2_2 379..403 CDD:404364 15/23 (65%)
C2H2 Zn finger 394..415 CDD:275368 8/20 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.