DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12605 and Bcl6b

DIOPT Version :9

Sequence 1:NP_001261387.1 Gene:CG12605 / 38468 FlyBaseID:FBgn0035481 Length:619 Species:Drosophila melanogaster
Sequence 2:NP_031554.1 Gene:Bcl6b / 12029 MGIID:1278332 Length:474 Species:Mus musculus


Alignment Length:392 Identity:105/392 - (26%)
Similarity:145/392 - (36%) Gaps:76/392 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 RDRMREQQLVAATAAASIYRGRSVEET-----EAAHDLLSLS----QSLPPLIPPCVVTIMKQEQ 274
            |.|:......|..|||:..:...|.:.     :|:::.|.:|    :..||..|........:..
Mouse   100 RLRLSPATAPAVLAAATYLQMEHVVQACHRFIQASYEPLGISLRPVEVEPPRPPTVAPPGSPRRS 164

  Fly   275 EQLRSPEIQEISNSASSRSPQS---------TIRFIGSSSYDLMGGSSEGANNCSPLTPPNSDHS 330
            |....|..:..|.|..|.||.|         ..:||..:|.....||..|.::..| .|.....|
Mouse   165 EGHPDPPTESRSCSQGSPSPASPDPKACNWKKYKFIVLNSQTSQAGSLVGESSGQP-CPQARLPS 228

  Fly   331 SDVDIDMSSSSESGLQQWGKPNPQQNQQRASALKMCLNMLDGRTKASKAAAVTKQDRQEPMQPRP 395
            .|.....|||||.|.    .|..|.....|:.           |...|..|:.  :......||.
Mouse   229 GDEACSSSSSSEEGT----TPGLQSRLSLATT-----------TARFKCGALA--NNSYLFTPRA 276

  Fly   396 KSAQSNASSGGGPPSEPPENPAASLGHSSSGNGENYAKRKRGC---------------YKCCECG 445
            :.....||....||      |.:..  .|..|.|..|    ||               |||..|.
Mouse   277 QETSLPASKQANPP------PGSEF--FSCQNCEAVA----GCSSGLELLAPGDEDKPYKCQLCR 329

  Fly   446 KQYATSSNLSRHKQTHRSLDSQSAKKCNTCGKAYVSMPALAMHLLTHKLSHS------CDICGKL 504
            ..:....||:.|:..|   ..:...:|:.|| |..:.||   :|.||...||      |:.||..
Mouse   330 SAFRYKGNLASHRTVH---TGEKPYRCSICG-ARFNRPA---NLKTHSRIHSGEKPYKCETCGSR 387

  Fly   505 FSRPWLLQGHLRSHTGEKPYACVHCGKAFADRSNLRAHMQTHSGDKNFKCHRCNKTFALKSYLNK 569
            |.:...|:.|:..|||||||.|..||..|.....|::|::.|:|:|.:.|..|...|..||.|..
Mouse   388 FVQVAHLRAHVLIHTGEKPYPCPTCGTRFRHLQTLKSHVRIHTGEKPYHCDPCGLHFRHKSQLRL 452

  Fly   570 HL 571
            ||
Mouse   453 HL 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12605NP_001261387.1 zf-C2H2 439..461 CDD:278523 7/21 (33%)
C2H2 Zn finger 441..461 CDD:275370 5/19 (26%)
C2H2 Zn finger 472..492 CDD:275368 7/19 (37%)
COG5048 492..>570 CDD:227381 31/83 (37%)
zf-C2H2 496..518 CDD:278523 8/27 (30%)
C2H2 Zn finger 498..518 CDD:275368 6/19 (32%)
zf-H2C2_2 511..534 CDD:290200 12/22 (55%)
zf-C2H2 524..546 CDD:278523 7/21 (33%)
C2H2 Zn finger 526..546 CDD:275368 6/19 (32%)
zf-H2C2_2 538..562 CDD:290200 7/23 (30%)
C2H2 Zn finger 554..571 CDD:275368 6/16 (38%)
Bcl6bNP_031554.1 BTB 28..132 CDD:279045 7/31 (23%)
BTB 39..131 CDD:197585 7/30 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 144..190 11/45 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..249 14/43 (33%)
C2H2 Zn finger 325..345 CDD:275368 5/19 (26%)
zf-H2C2_2 337..362 CDD:290200 8/28 (29%)
C2H2 Zn finger 353..373 CDD:275368 9/23 (39%)
zf-H2C2_2 365..390 CDD:290200 9/24 (38%)
C2H2 Zn finger 381..401 CDD:275368 6/19 (32%)
zf-H2C2_2 393..418 CDD:290200 13/24 (54%)
C2H2 Zn finger 409..429 CDD:275368 6/19 (32%)
zf-H2C2_2 422..446 CDD:290200 8/23 (35%)
C2H2 Zn finger 437..455 CDD:275368 8/18 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.