DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12605 and ZBTB18

DIOPT Version :9

Sequence 1:NP_001261387.1 Gene:CG12605 / 38468 FlyBaseID:FBgn0035481 Length:619 Species:Drosophila melanogaster
Sequence 2:NP_991331.1 Gene:ZBTB18 / 10472 HGNCID:13030 Length:531 Species:Homo sapiens


Alignment Length:528 Identity:118/528 - (22%)
Similarity:186/528 - (35%) Gaps:141/528 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 GKVKFDD---KSPLTASSVLKNANGNGLGTGGKSPLKSLAKRNSRSILKREIIDLDDEDGEEQED 119
            ||::|.|   :..|.|:|.|...:   :....|..||..|...:.|..|       :||.....|
Human    94 GKLQFKDLPIEDVLAAASYLHMYD---IVKVCKKKLKEKATTEADSTKK-------EEDASSCSD 148

  Fly   120 QLCEHLEWSAAQSLVQMNSSKQE-KQRRAGTTGSPATVAAPVSASVSLRRPVGRA--PAEDGKVI 181
            :: |.|...::.....:.|.:.| :..:.....|...:||. ..::.:|.|...|  |...|:. 
Human   149 KV-ESLSDGSSHIAGDLPSDEDEGEDEKLNILPSKRDLAAE-PGNMWMRLPSDSAGIPQAGGEA- 210

  Fly   182 FYAPPASASGSPRQPEPVALKRERERDKEREREKERERDRMREQQLVAATAAASIYRGRS-VEET 245
              .|.|:|:|          |.........|...:|....:|:...|......|:....| ||..
Human   211 --EPHATAAG----------KTVASPCSSTESLSQRSVTSVRDSADVDCVLDLSVKSSLSGVENL 263

  Fly   246 EAAHDLLSLSQSLPPLIPPCVVTIMKQEQEQLRSPEIQ-EISNSASSRSPQSTIRFIGSSSYDLM 309
            .:::                     ...|:.|||..:| ::...||.....     :|::.||: 
Human   264 NSSY---------------------FSSQDVLRSNLVQVKVEKEASCDESD-----VGTNDYDM- 301

  Fly   310 GGSSEGANNCSPLTPPNSDHSSDVDIDMSSSSESGLQQWGKPNPQQNQQRASALKMCLNMLDGRT 374
                              :||:   :..|.|:.:.:|.  :|......:..|.|:    .||...
Human   302 ------------------EHST---VKESVSTNNRVQY--EPAHLAPLREDSVLR----ELDRED 339

  Fly   375 KASKAAAVTKQDRQEPMQPRPKSAQSNASSGGGPPSEPPE-----NPAASLGHSSSGNGENYAKR 434
            |||.         .|.|.|..:..|   ..||...|..|.     :||..:              
Human   340 KASD---------DEMMTPESERVQ---VEGGMESSLLPYVSNILSPAGQI-------------- 378

  Fly   435 KRGCYKCCECGKQYATSSNLSRHKQTH-RSLDSQSAKKCNTCGKAYVSMPALAMHLLTHKLSHSC 498
                :.|..|.|.:.:...|..|..|| |..|...:|..     |.|::|             :|
Human   379 ----FMCPLCNKVFPSPHILQIHLSTHFREQDGIRSKPA-----ADVNVP-------------TC 421

  Fly   499 DICGKLFSRPWLLQGHLRSHTGEKPYACVHCGKAFADRSNLRAHMQTHSGDKNFKCHRCNKTFAL 563
            .:|||.||..:.|:.|.|:|:|||||.|..|||:|....||..|...|:.:|...|..|.:.|..
Human   422 SLCGKTFSCMYTLKRHERTHSGEKPYTCTQCGKSFQYSHNLSRHAVVHTREKPHACKWCERRFTQ 486

  Fly   564 KSYLNKHL 571
            ...|.:|:
Human   487 SGDLYRHI 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12605NP_001261387.1 zf-C2H2 439..461 CDD:278523 5/21 (24%)
C2H2 Zn finger 441..461 CDD:275370 5/19 (26%)
C2H2 Zn finger 472..492 CDD:275368 3/19 (16%)
COG5048 492..>570 CDD:227381 29/77 (38%)
zf-C2H2 496..518 CDD:278523 9/21 (43%)
C2H2 Zn finger 498..518 CDD:275368 9/19 (47%)
zf-H2C2_2 511..534 CDD:290200 13/22 (59%)
zf-C2H2 524..546 CDD:278523 9/21 (43%)
C2H2 Zn finger 526..546 CDD:275368 8/19 (42%)
zf-H2C2_2 538..562 CDD:290200 7/23 (30%)
C2H2 Zn finger 554..571 CDD:275368 4/16 (25%)
ZBTB18NP_991331.1 BTB 23..119 CDD:279045 8/27 (30%)
BTB 34..119 CDD:197585 8/27 (30%)
COG5048 <303..>490 CDD:227381 64/243 (26%)
C2H2 Zn finger 381..401 CDD:275368 5/19 (26%)
C2H2 Zn finger 421..441 CDD:275368 9/19 (47%)
zf-H2C2_2 434..456 CDD:290200 13/21 (62%)
C2H2 Zn finger 449..469 CDD:275368 8/19 (42%)
C2H2 Zn finger 477..495 CDD:275368 5/18 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.