DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12605 and zbtb7c

DIOPT Version :9

Sequence 1:NP_001261387.1 Gene:CG12605 / 38468 FlyBaseID:FBgn0035481 Length:619 Species:Drosophila melanogaster
Sequence 2:XP_003200858.1 Gene:zbtb7c / 100537080 -ID:- Length:610 Species:Danio rerio


Alignment Length:418 Identity:93/418 - (22%)
Similarity:150/418 - (35%) Gaps:112/418 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 ERERDKEREREKERERDRM------REQQLVAATAAASIYRGRSVEETEAAHDLLSLSQSLPPLI 262
            |.:.|:|.|.|.|.|.|..      ...:..|......:..|:..|..||..             
Zfish   153 EDDEDEEEEEEMEEEVDSKDGEFEDNNSEKSAQGDGPDVQEGKVWEVREAES------------- 204

  Fly   263 PPCVVTIMKQEQE--QLRSPEIQEISNSASSRSPQ----------STIRFIGSSSYDLMGGSSEG 315
            |.|.....:.|.:  |:.|||..:   |...|:|:          |....:....|..:.|...|
Zfish   205 PSCSSQKGRDESQRSQVGSPEAPQ---SDKPRAPEGLEGRALKDFSIESLLQEGLYPKVPGLERG 266

  Fly   316 ANNCSPLTP---PNSDHSSDVDIDMSSSSESGLQQWGKPNPQQNQQRASALKMCLNMLDGRTKAS 377
            | ..|||.|   |                    ..|....|...|           :|:.|....
Zfish   267 A-GFSPLLPGFYP--------------------PMWAAEFPGYPQ-----------ILEPRRPFP 299

  Fly   378 KAA--------AVTKQDRQEPMQPRPKSAQSN-------ASSGGGPPSEPPENPAASLGHSSSGN 427
            .|:        ||.|:..:|.::..|.:...|       .|.|.|..::|      |||....|.
Zfish   300 NASLENGPLDLAVKKEVIKEELKDEPTNPILNRDFLKDFMSPGLGMTADP------SLGAIKEGT 358

  Fly   428 G-ENYAKRKRGCYKCCECGKQYATSSNLSR-----HKQTHRSLDSQSAKKCNTCGKAYVSMPALA 486
            . .:|.              .:.::|:|..     ..:..|.:..:::::|..|.|.......|.
Zfish   359 DLRSYL--------------NFLSASHLGTLFPPWQLEEERKMKPKASQQCPICNKVIQGAGKLP 409

  Fly   487 MHLLTH--KLSHSCDICGKLFSRPWLLQGHLRSHTGEKPYACVHCGKAFADRSNLRAHMQTHSGD 549
            .|:.||  :..:.|.||...|:|...|:.|:|.||||:||.|:||...|....:|:.|::.|:|.
Zfish   410 RHMRTHTGEKPYMCTICEVRFTRQDKLKIHMRKHTGERPYICLHCNSKFVHNYDLKNHLRIHTGV 474

  Fly   550 KNFKCHRCNKTFALKSYLNKHLESACLR 577
            :.::|..|.|:|....:|::|::....|
Zfish   475 RPYQCEHCYKSFTRSDHLHRHIKRQSCR 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12605NP_001261387.1 zf-C2H2 439..461 CDD:278523 2/26 (8%)
C2H2 Zn finger 441..461 CDD:275370 2/24 (8%)
C2H2 Zn finger 472..492 CDD:275368 5/19 (26%)
COG5048 492..>570 CDD:227381 28/79 (35%)
zf-C2H2 496..518 CDD:278523 8/21 (38%)
C2H2 Zn finger 498..518 CDD:275368 8/19 (42%)
zf-H2C2_2 511..534 CDD:290200 12/22 (55%)
zf-C2H2 524..546 CDD:278523 7/21 (33%)
C2H2 Zn finger 526..546 CDD:275368 6/19 (32%)
zf-H2C2_2 538..562 CDD:290200 7/23 (30%)
C2H2 Zn finger 554..571 CDD:275368 5/16 (31%)
zbtb7cXP_003200858.1 BTB 24..132 CDD:279045
BTB 35..133 CDD:197585
C2H2 Zn finger 395..415 CDD:275368 5/19 (26%)
zf-H2C2_2 410..432 CDD:290200 7/21 (33%)
C2H2 Zn finger 423..443 CDD:275368 8/19 (42%)
zf-H2C2_2 436..460 CDD:290200 13/23 (57%)
C2H2 Zn finger 451..471 CDD:275368 6/19 (32%)
zf-H2C2_2 463..488 CDD:290200 8/24 (33%)
C2H2 Zn finger 479..497 CDD:275368 6/17 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.