DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12605 and ZBTB42

DIOPT Version :9

Sequence 1:NP_001261387.1 Gene:CG12605 / 38468 FlyBaseID:FBgn0035481 Length:619 Species:Drosophila melanogaster
Sequence 2:NP_001131073.1 Gene:ZBTB42 / 100128927 HGNCID:32550 Length:422 Species:Homo sapiens


Alignment Length:466 Identity:103/466 - (22%)
Similarity:145/466 - (31%) Gaps:193/466 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 LVQMNSSKQEKQRRAGTTGSPATVAAPVSASVSLRRPVGRA----PAEDGKV----IFYAPPASA 189
            :|::...:.:::.|:...|:||..|.|  |......||..|    .|...|:    :..|.|..|
Human   110 IVKVCKGRLQEKDRSLDPGNPAPGAEP--AQPPCPWPVWTADLCPAARKAKLPPFGVKAALPPRA 172

  Fly   190 SGSP--RQPEPVALKRERERDKEREREKERERDRMREQQLVAATAAASIYRGRSVEETEAAHDLL 252
            ||.|  :.||                    |.|:..:..|            :|....|..|   
Human   173 SGPPPCQVPE--------------------ESDQALDLSL------------KSGPRQERVH--- 202

  Fly   253 SLSQSLPPLIPPCVV-------------TIMKQEQEQLRSPEIQEISNSASSRSPQSTIRFIGSS 304
                      ||||:             .::|.|::.|...|     .|:|||||.|        
Human   203 ----------PPCVLQTPLCSQRQPGAQPLVKDERDSLSEQE-----ESSSSRSPHS-------- 244

  Fly   305 SYDLMGGSSEGANNCSPLTPPNSDHSSDVDIDMSSSSESGLQQWGKPNPQQNQQRASALKMCLNM 369
                               ||                        ||.|                
Human   245 -------------------PP------------------------KPPP---------------- 250

  Fly   370 LDGRTKASKAAAVTKQDRQEPMQPRPKSAQSNAS---SGGGPPSEPPENPAASLGHSSSGNGENY 431
                ..|:|...|       .:||.|.|.:.:..   ..|...||....|...|           
Human   251 ----VPAAKGLVV-------GLQPLPLSGEGSRELELGAGRLASEDELGPGGPL----------- 293

  Fly   432 AKRKRGCYKCCECGKQYATSSNLSRHKQTH-RSLDSQSAKKCNTCGKAYVSMPALAMHLLTHKLS 495
                  |. |..|.|.:.:|..|..|...| |..||..|:                  |....::
Human   294 ------CI-CPLCSKLFPSSHVLQLHLSAHFRERDSTRAR------------------LSPDGVA 333

  Fly   496 HSCDICGKLFSRPWLLQGHLRSHTGEKPYACVHCGKAFADRSNLRAHMQTHSGDKNFKCHRCNKT 560
            .:|.:|||.||..:.|:.|.|:|:|||||.||.|||:|....||..|...|:.:|...|..|.:.
Human   334 PTCPLCGKTFSCTYTLKRHERTHSGEKPYTCVQCGKSFQYSHNLSRHTVVHTREKPHACRWCERR 398

  Fly   561 FALKSYLNKHL 571
            |.....|.:|:
Human   399 FTQSGDLYRHV 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12605NP_001261387.1 zf-C2H2 439..461 CDD:278523 6/21 (29%)
C2H2 Zn finger 441..461 CDD:275370 6/19 (32%)
C2H2 Zn finger 472..492 CDD:275368 1/19 (5%)
COG5048 492..>570 CDD:227381 30/77 (39%)
zf-C2H2 496..518 CDD:278523 9/21 (43%)
C2H2 Zn finger 498..518 CDD:275368 9/19 (47%)
zf-H2C2_2 511..534 CDD:290200 14/22 (64%)
zf-C2H2 524..546 CDD:278523 10/21 (48%)
C2H2 Zn finger 526..546 CDD:275368 9/19 (47%)
zf-H2C2_2 538..562 CDD:290200 7/23 (30%)
C2H2 Zn finger 554..571 CDD:275368 4/16 (25%)
ZBTB42NP_001131073.1 BTB_POZ_ZBTB42 1..129 CDD:349737 2/18 (11%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 121..141 7/21 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 166..188 10/41 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 207..256 17/124 (14%)
COG5048 <292..>405 CDD:227381 43/148 (29%)
C2H2 Zn finger 296..316 CDD:275368 6/19 (32%)
C2H2 Zn finger 336..356 CDD:275368 9/19 (47%)
zf-H2C2_2 349..371 CDD:338759 14/21 (67%)
C2H2 Zn finger 364..384 CDD:275368 9/19 (47%)
C2H2 Zn finger 392..410 CDD:275368 5/18 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.