DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12605 and zbtb49

DIOPT Version :9

Sequence 1:NP_001261387.1 Gene:CG12605 / 38468 FlyBaseID:FBgn0035481 Length:619 Species:Drosophila melanogaster
Sequence 2:NP_001076468.1 Gene:zbtb49 / 100009630 ZFINID:ZDB-GENE-070209-170 Length:524 Species:Danio rerio


Alignment Length:397 Identity:101/397 - (25%)
Similarity:147/397 - (37%) Gaps:110/397 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 EAAHDLLSLSQSLPPL---------IPPCVVTIMKQEQEQLRSPEIQEISNSASSRSPQSTIRFI 301
            |..|.||.:.|||..|         :.|||              .....|:...|..|:..    
Zfish    92 ENVHTLLEIGQSLQVLNVLNMCHAFLKPCV--------------SADSASSCCVSAGPECV---- 138

  Fly   302 GSSSYDLMGGSSEGANNCSPLTPPNSDHSSDVDIDMSSSSESGLQQWGKPNPQQNQQRASALKMC 366
                      |..||:  .|..||   |:..:   .|..|...|||.....|..:...|...|..
Zfish   139 ----------SGPGAS--EPQEPP---HTHKL---RSFYSRQYLQQSPAAGPAPSGPGAPQHKKT 185

  Fly   367 LNMLDGRTKASKAAAVTKQDRQE--------PMQP-RPKSAQSNAS-----------------SG 405
            |.:       .|...:..|:.:|        |..| .|.||.:..|                 |.
Zfish   186 LYV-------KKFNYLRSQEEEEERCAGGHAPCGPATPSSADTTPSDLCVTSDLCVTPDLCVTSD 243

  Fly   406 GGPPSEPPENPAASLGHS-----------SSGNGENYAKRKRGCYKCCE-CGKQYATSSNLSRHK 458
            ....:|....|.|..|::           |.|.|..|         ||| |||.:...|||..||
Zfish   244 PAEAAELERTPEAEPGNTGPQGQEQRSGVSGGGGNKY---------CCEVCGKTFKHPSNLELHK 299

  Fly   459 QTHRSLDSQSAKKCNTCGKAYVSMPALAMHLLTH--KLSHSCDICGKLFSRPWLLQGHLRSHTGE 521
            ::|   ..:...:|:.||||:.....|..||..|  :..:.|::|||.|:....:|.|:..|:|.
Zfish   300 RSH---TGEKPFQCSVCGKAFSQAGNLQTHLRRHSGEKPYICELCGKSFAASGDVQRHIIIHSGA 361

  Fly   522 KPYACVHCGKAFADRSNLRAHMQTHSGDKNFKCHRCNKTFALKSYLNKHL------ESACLRDAG 580
            :|:.|..||:.|::.|||:.|.:||..::.|.|.:|.|:|.::..|.||.      :..|.:..|
Zfish   362 RPHLCDVCGRGFSNFSNLKEHKKTHRAEREFTCDQCGKSFNMQRKLLKHKSRHSGDKPYCCQTCG 426

  Fly   581 AIDQGKG 587
            ....|.|
Zfish   427 KCFAGSG 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12605NP_001261387.1 zf-C2H2 439..461 CDD:278523 11/22 (50%)
C2H2 Zn finger 441..461 CDD:275370 11/20 (55%)
C2H2 Zn finger 472..492 CDD:275368 8/19 (42%)
COG5048 492..>570 CDD:227381 27/79 (34%)
zf-C2H2 496..518 CDD:278523 7/21 (33%)
C2H2 Zn finger 498..518 CDD:275368 7/19 (37%)
zf-H2C2_2 511..534 CDD:290200 8/22 (36%)
zf-C2H2 524..546 CDD:278523 8/21 (38%)
C2H2 Zn finger 526..546 CDD:275368 8/19 (42%)
zf-H2C2_2 538..562 CDD:290200 9/23 (39%)
C2H2 Zn finger 554..571 CDD:275368 6/16 (38%)
zbtb49NP_001076468.1 zf-H2C2_2 322..346 CDD:290200 8/23 (35%)
C2H2 Zn finger 338..358 CDD:275368 7/19 (37%)
C2H2 Zn finger 366..386 CDD:275368 8/19 (42%)
zf-H2C2_2 378..402 CDD:290200 9/23 (39%)
C2H2 Zn finger 394..414 CDD:275368 7/19 (37%)
zf-H2C2_2 407..430 CDD:290200 5/22 (23%)
C2H2 Zn finger 422..442 CDD:275368 3/12 (25%)
zf-H2C2_2 434..459 CDD:290200 101/397 (25%)
C2H2 Zn finger 450..467 CDD:275368
BTB 15..118 CDD:279045 8/25 (32%)
BTB 26..118 CDD:197585 8/25 (32%)
zf-C2H2 280..302 CDD:278523 12/30 (40%)
C2H2 Zn finger 282..302 CDD:275368 10/19 (53%)
COG5048 <292..466 CDD:227381 47/145 (32%)
zf-H2C2_2 294..319 CDD:290200 10/27 (37%)
C2H2 Zn finger 310..330 CDD:275368 8/19 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.