DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14983 and AT5G48655

DIOPT Version :9

Sequence 1:NP_647843.1 Gene:CG14983 / 38466 FlyBaseID:FBgn0035479 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_001318762.1 Gene:AT5G48655 / 834923 AraportID:AT5G48655 Length:203 Species:Arabidopsis thaliana


Alignment Length:174 Identity:38/174 - (21%)
Similarity:74/174 - (42%) Gaps:46/174 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PKIVDLLKELQEQEKEIQEIILEESFASPEQRLAQLESVTSRMHLYHSRRGNILMSLQQELGKYE 69
            |.::|:        ..|::.::|.|.::    .|:.:| .||    ::||..:::.:  |.|...
plant    49 PTMIDV--------DAIEDDVIESSASA----FAEAKS-KSR----NARRRPLMVDV--ESGGTT 94

  Fly    70 YFTLLV----RHIAQTHSYL----KSLNKALDFLYKVN--------------ICSICDLKCEPHG 112
            .|...:    |.|..:.|.:    .|:|..::...:|:              .|.||  .| |..
plant    95 RFPANISNKRRRIPSSESVIDCEHASVNDEVNMSSRVSRSKAPAPPPEEPKFTCPIC--MC-PFT 156

  Fly   113 RHSMVSLRCGHLFGRHCINNVLRESSRCPTCSRRARHHEVRRIY 156
            ..  :|.:|||:|.:.||...:....:||||.::....|:.|::
plant   157 EE--MSTKCGHIFCKGCIKMAISRQGKCPTCRKKVTAKELIRVF 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14983NP_647843.1 zf-RING_2 99..143 CDD:290367 14/57 (25%)
AT5G48655NP_001318762.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001208
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.