DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14983 and AT5G37280

DIOPT Version :9

Sequence 1:NP_647843.1 Gene:CG14983 / 38466 FlyBaseID:FBgn0035479 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_198544.1 Gene:AT5G37280 / 833702 AraportID:AT5G37280 Length:216 Species:Arabidopsis thaliana


Alignment Length:162 Identity:34/162 - (20%)
Similarity:62/162 - (38%) Gaps:45/162 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 IQEIILEESFASPEQRLAQLESVTSRMHLYHSRRGNILMSLQQELGKYEY-------------FT 72
            |..::|:.....||| |::|  :..::|    |..:|..||.:::....:             .|
plant    55 ISHVLLKPRSFLPEQ-LSRL--LRRQLH----RDTSICESLAEKISSLRFSRANYTLYQRPFLMT 112

  Fly    73 LLVRHIAQTHSYLK-----SLNKALDFLYKV-------------NICSIC-----DLKCEPHGRH 114
            :.||.|.:....:.     |....:|...::             ..||||     |...|.: .:
plant   113 VKVRVIKEVRFIVSPVSAPSSGAPVDVFQRLLEEQTVEPSMDSDESCSICFEKLSDSLSETY-HN 176

  Fly   115 SMVSL-RCGHLFGRHCINNVLRESSRCPTCSR 145
            |::.: :|.|.|.:.||...:...:.||.|.|
plant   177 SIIQMPKCLHSFHQKCIFKWIGRQNSCPLCRR 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14983NP_647843.1 zf-RING_2 99..143 CDD:290367 14/49 (29%)
AT5G37280NP_198544.1 COG5540 <107..207 CDD:227827 20/100 (20%)
RING_Ubox 158..207 CDD:388418 14/49 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I2695
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.