powered by:
Protein Alignment CG14983 and AT5G03450
DIOPT Version :9
Sequence 1: | NP_647843.1 |
Gene: | CG14983 / 38466 |
FlyBaseID: | FBgn0035479 |
Length: | 163 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_195965.2 |
Gene: | AT5G03450 / 831835 |
AraportID: | AT5G03450 |
Length: | 630 |
Species: | Arabidopsis thaliana |
Alignment Length: | 59 |
Identity: | 23/59 - (38%) |
Similarity: | 31/59 - (52%) |
Gaps: | 3/59 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 101 CSICDLKCEPHGRHSMVSLRCGHLFGRHCINNVL---RESSRCPTCSRRARHHEVRRIY 156
||||.......|:|.:..|.||||:|..|||... |...:||.|::.....:||:||
plant 120 CSICMEVWTSGGQHQVCCLPCGHLYGYSCINKWFQQRRSGGKCPLCNKICSLRDVRKIY 178
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
1 |
1.000 |
54 |
1.000 |
Domainoid score |
I4143 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1451258at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.920 |
|
Return to query results.
Submit another query.