DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14983 and AT5G03450

DIOPT Version :9

Sequence 1:NP_647843.1 Gene:CG14983 / 38466 FlyBaseID:FBgn0035479 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_195965.2 Gene:AT5G03450 / 831835 AraportID:AT5G03450 Length:630 Species:Arabidopsis thaliana


Alignment Length:59 Identity:23/59 - (38%)
Similarity:31/59 - (52%) Gaps:3/59 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 CSICDLKCEPHGRHSMVSLRCGHLFGRHCINNVL---RESSRCPTCSRRARHHEVRRIY 156
            ||||.......|:|.:..|.||||:|..|||...   |...:||.|::.....:||:||
plant   120 CSICMEVWTSGGQHQVCCLPCGHLYGYSCINKWFQQRRSGGKCPLCNKICSLRDVRKIY 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14983NP_647843.1 zf-RING_2 99..143 CDD:290367 18/44 (41%)
AT5G03450NP_195965.2 mRING-C3HGC3_RFWD3 116..166 CDD:319364 18/45 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4143
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1451258at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.