powered by:
Protein Alignment CG14983 and AT3G42940
DIOPT Version :9
Sequence 1: | NP_647843.1 |
Gene: | CG14983 / 38466 |
FlyBaseID: | FBgn0035479 |
Length: | 163 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_189880.1 |
Gene: | AT3G42940 / 823349 |
AraportID: | AT3G42940 |
Length: | 193 |
Species: | Arabidopsis thaliana |
Alignment Length: | 62 |
Identity: | 16/62 - (25%) |
Similarity: | 32/62 - (51%) |
Gaps: | 8/62 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 PKIVDLL-KELQEQEKEIQEIILEESFAS--PEQRLAQLESVTSRMHLYHSRRGNILMSLQQ 63
|...||: ||..|:|.|...|.||:...| .::::.::.:. .|::: .|.::.||.:
plant 137 PSTPDLVEKEAAEEETEACAICLEDMLESGFDDKQIYRMHNC---WHMFY--EGCVMESLNR 193
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG14983 | NP_647843.1 |
zf-RING_2 |
99..143 |
CDD:290367 |
|
AT3G42940 | NP_189880.1 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
42 |
1.000 |
Inparanoid score |
I2695 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.050 |
|
Return to query results.
Submit another query.