DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14983 and AT3G28620

DIOPT Version :9

Sequence 1:NP_647843.1 Gene:CG14983 / 38466 FlyBaseID:FBgn0035479 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_189503.1 Gene:AT3G28620 / 822492 AraportID:AT3G28620 Length:211 Species:Arabidopsis thaliana


Alignment Length:152 Identity:28/152 - (18%)
Similarity:55/152 - (36%) Gaps:51/152 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DLLKELQEQEKEIQEIILEESFASPEQR-LAQLESVTSRMHLYHSRRGNILM------------- 59
            ||.::|..:..:.|:....:||..|:|| |..:.||.....:|     |::.             
plant    89 DLSEQLSYKIVQAQQRQKRQSFYLPQQRPLFMIVSVKLTHKVY-----NVVSCDSAPLATDFDQE 148

  Fly    60 SLQQELGKYEYFTLLVRHIAQTHSYLKSLNKALDFLYKVNICSICDLKCEPHGRHSMVSLRCGHL 124
            |.|:|..:.:...:.:.::.::..|                   |::.            .|.|.
plant   149 SQQEEEEESKTCAICLENLLRSEDY-------------------CEMP------------TCSHY 182

  Fly   125 FGRHCINNVL-RESSRCPTCSR 145
            |...|:...| |:::.||.|.:
plant   183 FHEPCLTEWLTRDNNSCPLCRK 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14983NP_647843.1 zf-RING_2 99..143 CDD:290367 9/44 (20%)
AT3G28620NP_189503.1 RING_Ubox 159..203 CDD:388418 10/74 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I2695
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.