powered by:
Protein Alignment CG14983 and AT3G07200
DIOPT Version :9
Sequence 1: | NP_647843.1 |
Gene: | CG14983 / 38466 |
FlyBaseID: | FBgn0035479 |
Length: | 163 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001078119.1 |
Gene: | AT3G07200 / 819908 |
AraportID: | AT3G07200 |
Length: | 182 |
Species: | Arabidopsis thaliana |
Alignment Length: | 56 |
Identity: | 20/56 - (35%) |
Similarity: | 32/56 - (57%) |
Gaps: | 5/56 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 101 CSICDLKCEPHGRHSMVSLRCGHLFGRHCINNVLRESSRCPTCSRRARHHEVRRIY 156
|.|| .| |..:. ||.:|||:|.:.||.|.|...::||||.::....::.|::
plant 127 CPIC--LC-PFTQE--VSTKCGHIFCKKCIKNALSLQAKCPTCRKKITVKDLIRVF 177
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG14983 | NP_647843.1 |
zf-RING_2 |
99..143 |
CDD:290367 |
17/41 (41%) |
AT3G07200 | NP_001078119.1 |
RING |
127..168 |
CDD:238093 |
19/45 (42%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0001208 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.