DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14983 and RFWD3

DIOPT Version :9

Sequence 1:NP_647843.1 Gene:CG14983 / 38466 FlyBaseID:FBgn0035479 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_001357463.1 Gene:RFWD3 / 55159 HGNCID:25539 Length:774 Species:Homo sapiens


Alignment Length:147 Identity:37/147 - (25%)
Similarity:64/147 - (43%) Gaps:38/147 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 EQEKEIQEIILEESFA--SPEQRLAQLESVTSRMHLYHSRRGNILM---SLQQELGKYEYFTLLV 75
            :|.:|...:||||..|  |.||.:..::...:.......::...|:   |:.:|.|         
Human   229 DQAEESGAVILEEQLAGVSAEQEVTCIDGGKTLPKQPSPQKSEPLLPSASMDEEEG--------- 284

  Fly    76 RHIAQTHSYLKSLNKALDFLYKVNICSICDLKCEPHGRHSMVSLRCGHLFGRHCINNVLR-ESSR 139
                                   :.|:||..:....|.|.:.:||||||||..||:..|: :..:
Human   285 -----------------------DTCTICLEQWTNAGDHRLSALRCGHLFGYRCISTWLKGQVRK 326

  Fly   140 CPTCSRRARHHEVRRIY 156
            ||.|:::|||.::..:|
Human   327 CPQCNKKARHSDIVVLY 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14983NP_647843.1 zf-RING_2 99..143 CDD:290367 18/44 (41%)
RFWD3NP_001357463.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 95..116
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 139..225
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 257..280 2/22 (9%)
mRING-C3HGC3_RFWD3 283..331 CDD:319364 19/79 (24%)
WD40 <486..774 CDD:225201
WD 1 495..537
WD40 repeat 500..537 CDD:293791
WD 2 539..577
WD40 repeat 543..580 CDD:293791
WD 3 583..628
WD40 repeat 588..655 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146164
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7722
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1451258at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.800

Return to query results.
Submit another query.