DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14983 and rnf4

DIOPT Version :9

Sequence 1:NP_647843.1 Gene:CG14983 / 38466 FlyBaseID:FBgn0035479 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_001016554.1 Gene:rnf4 / 549308 XenbaseID:XB-GENE-1016982 Length:188 Species:Xenopus tropicalis


Alignment Length:160 Identity:42/160 - (26%)
Similarity:70/160 - (43%) Gaps:33/160 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PKIVDLLKELQEQEKEIQE--IILEESFASPEQRLA---QLESVTSRMHLYHSRRGNILMSLQQE 64
            |.:||    |...:..|.:  :|:|:   :|.||.|   ..:..||          .:|.|..::
 Frog    53 PVVVD----LTNNDLSINDSVVIVED---TPRQRRALSRPSQQTTS----------CVLSSDDED 100

  Fly    65 LGKYEYFTLLVRHIAQTHSYLKSLNKALDFLYKVNICSIC-DLKCE--PHGRHSMVSLRCGHLFG 126
            ....::|.......:|.:...:|.:.      ||: |.|| |...|  ..|| .:||.:|||:|.
 Frog   101 SRHADHFAANKDISSQAYGSSRSSSG------KVS-CPICMDSYSEIVQSGR-LIVSTKCGHIFC 157

  Fly   127 RHCINNVLRESSRCPTCSRRARHHEVRRIY 156
            ..|:.:.|:.:..||||.::..|.:...||
 Frog   158 SQCLRDALKNAPSCPTCRKKLNHKQYHPIY 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14983NP_647843.1 zf-RING_2 99..143 CDD:290367 17/46 (37%)
rnf4NP_001016554.1 zf-RING_2 129..175 CDD:290367 18/47 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001208
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.