DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14983 and CG13025

DIOPT Version :9

Sequence 1:NP_647843.1 Gene:CG14983 / 38466 FlyBaseID:FBgn0035479 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_001261971.1 Gene:CG13025 / 39874 FlyBaseID:FBgn0036660 Length:608 Species:Drosophila melanogaster


Alignment Length:167 Identity:44/167 - (26%)
Similarity:64/167 - (38%) Gaps:43/167 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 HLPKIVDLLKELQEQEKEIQEIILEESFASPEQRLAQLESVTSRMHLYHSRRGNILMSLQQELGK 67
            |||...   :..:..:.|.||:|..|:.:.|::|  :..|..:...|..|..|..::...::.|.
  Fly    70 HLPSPP---RNSRRNQGEEQEVISLETPSPPKKR--KRLSAAADKSLKKSPEGKPIVVDDEDDGM 129

  Fly    68 YEYFTLLVRHIAQTHSYLKSLNKALDFLYKVNICSICDLKCEPHGRHSMVSLRCGHLFGRHCINN 132
                                            .|.||....|..|.|.:||||||||||..||..
  Fly   130 --------------------------------TCPICLDSWEMSGEHRLVSLRCGHLFGESCIRR 162

  Fly   133 VLRESSR------CPTCSRRARHHEVRRIYGLKFYPL 163
            .|.||.|      ||.|..:|...::|.:|..:...|
  Fly   163 WLNESHRQSSVKVCPQCKTKATFRDIRHLYAKRIQML 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14983NP_647843.1 zf-RING_2 99..143 CDD:290367 24/49 (49%)
CG13025NP_001261971.1 zf-RING_2 130..180 CDD:290367 24/49 (49%)
WD40 <293..445 CDD:295369
WD40 <318..>415 CDD:225201
WD40 repeat 339..375 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447442
Domainoid 1 1.000 54 1.000 Domainoid score I4143
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7722
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1451258at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.