DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14983 and CG17329

DIOPT Version :9

Sequence 1:NP_647843.1 Gene:CG14983 / 38466 FlyBaseID:FBgn0035479 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_609784.2 Gene:CG17329 / 34958 FlyBaseID:FBgn0028896 Length:162 Species:Drosophila melanogaster


Alignment Length:157 Identity:65/157 - (41%)
Similarity:92/157 - (58%) Gaps:11/157 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KELQEQEKEIQEIILEESFASPEQRLAQLESVTSRMHLYHSRRGNILMSLQQELGKYEYFTLLVR 76
            |||:..|::.|| ..|.|..:.|:::.:|.....|:...:::|..||..||.::  .:|.||..|
  Fly     6 KELERTEQQQQE-PTEPSNGNLEEQVRKLRDHNLRVKHLNTQRRRILRLLQGKM--LQYATLEER 67

  Fly    77 -H-------IAQTHSYLKSLNKALDFLYKVNICSICDLKCEPHGRHSMVSLRCGHLFGRHCINNV 133
             |       ||:.||.:|:||:.||.:.:.:.||||.|....:|.|.:||||||||||..||:..
  Fly    68 LHRIGELVLIAELHSGVKTLNQRLDRMVENSTCSICLLPWTDNGIHRLVSLRCGHLFGSSCIHMA 132

  Fly   134 LRESSRCPTCSRRARHHEVRRIYGLKF 160
            :|.:.|||.|.|||||..|||||...|
  Fly   133 IRRNHRCPICRRRARHFHVRRIYSPSF 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14983NP_647843.1 zf-RING_2 99..143 CDD:290367 23/43 (53%)
CG17329NP_609784.2 zf-RING_2 99..143 CDD:290367 23/43 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447436
Domainoid 1 1.000 54 1.000 Domainoid score I4143
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I2695
Isobase 1 0.950 - 0 Normalized mean entropy S7722
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1451258at2759
OrthoFinder 1 1.000 - - FOG0001208
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.