DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14983 and CG31807

DIOPT Version :9

Sequence 1:NP_647843.1 Gene:CG14983 / 38466 FlyBaseID:FBgn0035479 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_723984.1 Gene:CG31807 / 318953 FlyBaseID:FBgn0051807 Length:155 Species:Drosophila melanogaster


Alignment Length:143 Identity:39/143 - (27%)
Similarity:64/143 - (44%) Gaps:13/143 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 EKEIQEIILEESFAS--PEQRLAQLESVTSRMHLYHSRRGNILMSLQQELGKYEYFTLLVRHIAQ 80
            :|::.|.:|.|...|  .:::||:|...|............:...:::|:..        :.:.|
  Fly    16 KKDVVEQLLAERKKSEQKDKQLAKLNITTQEKDKMREEELKLYYQMEEEITN--------QKLLQ 72

  Fly    81 THSYLKSLNKALDFLYKV---NICSICDLKCEPHGRHSMVSLRCGHLFGRHCINNVLRESSRCPT 142
            .....:|.::....|.|:   |.|.||....|....|.:||||||||||..||...|:.:..||.
  Fly    73 EQLLFESKDELTQQLEKIAIENTCCICLDPWEAKDHHRLVSLRCGHLFGEMCIRTHLQHADMCPI 137

  Fly   143 CSRRARHHEVRRI 155
            |.:.|...:|.|:
  Fly   138 CRKVAIERDVWRV 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14983NP_647843.1 zf-RING_2 99..143 CDD:290367 21/43 (49%)
CG31807NP_723984.1 zf-RING_2 94..139 CDD:290367 21/44 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447445
Domainoid 1 1.000 54 1.000 Domainoid score I4143
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I2695
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1451258at2759
OrthoFinder 1 1.000 - - FOG0001208
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.