DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14983 and Rnf128

DIOPT Version :9

Sequence 1:NP_647843.1 Gene:CG14983 / 38466 FlyBaseID:FBgn0035479 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_001166820.1 Gene:Rnf128 / 315911 RGDID:1566282 Length:428 Species:Rattus norvegicus


Alignment Length:44 Identity:14/44 - (31%)
Similarity:23/44 - (52%) Gaps:4/44 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 CSICDLKCEPHGRHSMVS-LRCGHLFGRHCINNVLRESSRCPTC 143
            |::|   .|.:..:.:|. |.|.|:|.:.|::..|.|...||.|
  Rat   277 CAVC---IELYKPNDVVRILTCNHIFHKTCVDPWLLEHRTCPMC 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14983NP_647843.1 zf-RING_2 99..143 CDD:290367 13/42 (31%)
Rnf128NP_001166820.1 PA_GRAIL_like 48..193 CDD:239037
zf-RING_2 275..318 CDD:290367 14/44 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.