powered by:
Protein Alignment CG14983 and Rnf128
DIOPT Version :9
Sequence 1: | NP_647843.1 |
Gene: | CG14983 / 38466 |
FlyBaseID: | FBgn0035479 |
Length: | 163 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001166820.1 |
Gene: | Rnf128 / 315911 |
RGDID: | 1566282 |
Length: | 428 |
Species: | Rattus norvegicus |
Alignment Length: | 44 |
Identity: | 14/44 - (31%) |
Similarity: | 23/44 - (52%) |
Gaps: | 4/44 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 101 CSICDLKCEPHGRHSMVS-LRCGHLFGRHCINNVLRESSRCPTC 143
|::| .|.:..:.:|. |.|.|:|.:.|::..|.|...||.|
Rat 277 CAVC---IELYKPNDVVRILTCNHIFHKTCVDPWLLEHRTCPMC 317
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
0 | 0.000 |
|
Return to query results.
Submit another query.