DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG14983 and Rnf4

DIOPT Version :9

Sequence 1:	NP_647843.1	Gene:	CG14983 / 38466	FlyBaseID:	FBgn0035479	Length:	163	Species:	Drosophila melanogaster
Sequence 2:	NP_062055.1	Gene:	Rnf4 / 29274	RGDID:	3583	Length:	194	Species:	Rattus norvegicus

Alignment Length:	59	Identity:	22/59 - (37%)
Similarity:	32/59 - (54%)	Gaps:	4/59 - (6%)

- Green bases have known domain annotations that are detailed below.

  Fly   101 CSIC-DLKCE--PHGRHSMVSLRCGHLFGRHCINNVLRESSRCPTCSRRARHHEVRRIY 156
            |.|| |...|  .:|| .:||..|||:|...|:.:.|:.::.||||.::..|.....||
  Rat   136 CPICMDGYSEIVQNGR-LIVSTECGHVFCSQCLRDSLKNANTCPTCRKKINHKRYHPIY 193

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG14983	NP_647843.1	zf-RING_2	99..143	CDD:290367	17/44 (39%)
Rnf4	NP_062055.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..36
		Required for ubiquitination activity. /evidence=ECO:0000250	1..20
		Mediates interaction with TRPS1. /evidence=ECO:0000250	6..65
		SUMO interaction motif 1. /evidence=ECO:0000269\|PubMed:18408734	40..43
		SUMO interaction motif 2. /evidence=ECO:0000269\|PubMed:18408734	50..53
		SUMO interaction motif 3. /evidence=ECO:0000269\|PubMed:18408734	61..63
		SUMO interaction motif 4. /evidence=ECO:0000269\|PubMed:18408734	71..74
		RING-HC_RNF4	131..184	CDD:319447	19/48 (40%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0001208
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.910