powered by:
Protein Alignment CG14983 and Rnf4
DIOPT Version :9
Sequence 1: | NP_647843.1 |
Gene: | CG14983 / 38466 |
FlyBaseID: | FBgn0035479 |
Length: | 163 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_062055.1 |
Gene: | Rnf4 / 29274 |
RGDID: | 3583 |
Length: | 194 |
Species: | Rattus norvegicus |
Alignment Length: | 59 |
Identity: | 22/59 - (37%) |
Similarity: | 32/59 - (54%) |
Gaps: | 4/59 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 101 CSIC-DLKCE--PHGRHSMVSLRCGHLFGRHCINNVLRESSRCPTCSRRARHHEVRRIY 156
|.|| |...| .:|| .:||..|||:|...|:.:.|:.::.||||.::..|.....||
Rat 136 CPICMDGYSEIVQNGR-LIVSTECGHVFCSQCLRDSLKNANTCPTCRKKINHKRYHPIY 193
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0001208 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.