DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14983 and rfp2

DIOPT Version :9

Sequence 1:NP_647843.1 Gene:CG14983 / 38466 FlyBaseID:FBgn0035479 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_593439.1 Gene:rfp2 / 2543192 PomBaseID:SPAC343.18 Length:205 Species:Schizosaccharomyces pombe


Alignment Length:184 Identity:42/184 - (22%)
Similarity:76/184 - (41%) Gaps:48/184 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PKIVDLLKELQEQEKEIQEIILEESFASPE----QRLAQLESVTSRMHLYHSRRGNI--LMSLQQ 63
            |:::||.:::::...::.|:.|.:....||    :|:.     |||.|| .:...|:  :.|:..
pombe    17 PEVIDLTEDIEDDGADVSEVTLLDLTRIPEFQPRRRIR-----TSRNHL-DANLSNVPTINSIPS 75

  Fly    64 EL--------GKYEYFTLLVRHIAQT-------HSYLKSLNKALD--------------FLYKV- 98
            .:        |...|.....|:.:||       :.:..|..||.|              |.|.| 
pombe    76 PVTRPPVAVGGGIFYGARRTRNRSQTQRRTLLENGFRNSRKKAQDSSNSIAERVSPPPGFCYDVH 140

  Fly    99 ---NI-CSICDLKCEPHGRHSMVSLRCGHLFGRHCINNVLRESSRCPT--CSRR 146
               || |:.|..:.....:.|:.:.:|||||...|...:.:::..||.  |.:|
pombe   141 PHNNIACAKCGNELVSDEKKSIFAAKCGHLFCSTCAKELRKKTVPCPVQHCRKR 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14983NP_647843.1 zf-RING_2 99..143 CDD:290367 13/46 (28%)
rfp2NP_593439.1 zf-RING_5 147..193 CDD:291308 12/45 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001208
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.