powered by:
Protein Alignment CG14983 and SPCC548.05c
DIOPT Version :9
Sequence 1: | NP_647843.1 |
Gene: | CG14983 / 38466 |
FlyBaseID: | FBgn0035479 |
Length: | 163 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_587745.1 |
Gene: | SPCC548.05c / 2539314 |
PomBaseID: | SPCC548.05c |
Length: | 468 |
Species: | Schizosaccharomyces pombe |
Alignment Length: | 72 |
Identity: | 22/72 - (30%) |
Similarity: | 33/72 - (45%) |
Gaps: | 11/72 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 76 RHIAQTHSYLKSLNKALDFLYKVNICSIC-DLKCEPHGRHSMVSLRCGHLFGRHCINNVLRESSR 139
:.|..|.:.|::..| :.|...|.|| :....|...| |||.:...|:.|.|:||..
pombe 64 KQIPDTKTLLETFQK----IKKTLECPICTEALQRPFTTH------CGHTYCYECLLNWLKESKS 118
Fly 140 CPTCSRR 146
||||.::
pombe 119 CPTCRQK 125
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG14983 | NP_647843.1 |
zf-RING_2 |
99..143 |
CDD:290367 |
15/44 (34%) |
SPCC548.05c | NP_587745.1 |
RING |
84..126 |
CDD:238093 |
17/48 (35%) |
COG2888 |
<193..213 |
CDD:268082 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0001208 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.000 |
|
Return to query results.
Submit another query.