DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14983 and T01G5.7

DIOPT Version :9

Sequence 1:NP_647843.1 Gene:CG14983 / 38466 FlyBaseID:FBgn0035479 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_506726.2 Gene:T01G5.7 / 187960 WormBaseID:WBGene00011342 Length:260 Species:Caenorhabditis elegans


Alignment Length:176 Identity:33/176 - (18%)
Similarity:64/176 - (36%) Gaps:38/176 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LPKIVDLLKELQEQEKEIQEIILEESFASPEQRLAQLESVTSRMHLYHSRRGNILMSLQQELGKY 68
            :.|:::..::||....|:.|  ..|...|.|.:..:|.:..|:|.:..|.....:|...::|...
 Worm    58 IEKVLETNQKLQLAFAELDE--QSEKINSLETQQHKLVAELSKMEIERSNSAIEIMKKDKQLRTT 120

  Fly    69 EYFTLLVRHIAQ-----THSYLKSLNKALDFLY---------KVNICSI---------------- 103
            |...:::.::.:     ...|...|..|.:.||         |.::|.:                
 Worm   121 EEQLIMMANLGEELGNDAKRYRSELESAHEELYQTYTIFDKEKSDLCELIEEQTKKLTESNAKQE 185

  Fly   104 ----CDLKCEPHGRHSMVS--LRCGHLFGRHCINNVLRESSRCPTC 143
                |.:.|..:.....:.  :.|||.....||.:.:.||...|.|
 Worm   186 SRKECPICCWNYDNEDRLPRVMDCGHTMCHTCIISTINESDTEPIC 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14983NP_647843.1 zf-RING_2 99..143 CDD:290367 11/65 (17%)
T01G5.7NP_506726.2 Smc <20..>189 CDD:224117 22/132 (17%)
RING_Ubox 189..236 CDD:388418 11/43 (26%)
modified RING-HC finger (C3HC3D-type) 190..234 CDD:319361 11/42 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.