DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14983 and Rfwd3

DIOPT Version :9

Sequence 1:NP_647843.1 Gene:CG14983 / 38466 FlyBaseID:FBgn0035479 Length:163 Species:Drosophila melanogaster
Sequence 2:XP_341691.8 Gene:Rfwd3 / 103690025 RGDID:1305243 Length:765 Species:Rattus norvegicus


Alignment Length:146 Identity:31/146 - (21%)
Similarity:62/146 - (42%) Gaps:33/146 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KELQEQEKEIQEIILEESFASPEQRLAQLESVTSRMHLYHSRRGNILMSLQQELGKYEYFTLLVR 76
            :|...:.:|.:..:.|:...|.:|..|.:....:.......::..:|.:::.|.|:         
  Rat   222 EEAAARAEEPEAAVPEQGVISTDQEAASVTGGDASPKKQSPQKPIVLPTVEDEEGE--------- 277

  Fly    77 HIAQTHSYLKSLNKALDFLYKVNICSICDLKCEPHGRHSMVSLRCGHLFGRHCINNVLR-ESSRC 140
                                   .|:||..:....|.|.:.:||||||||..||...|: ::.:|
  Rat   278 -----------------------TCTICLEQWTSAGDHRLSALRCGHLFGYRCIFKWLKGQTRKC 319

  Fly   141 PTCSRRARHHEVRRIY 156
            |.|:::|:|.::..:|
  Rat   320 PQCNKKAKHSDIVVLY 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14983NP_647843.1 zf-RING_2 99..143 CDD:290367 18/44 (41%)
Rfwd3XP_341691.8 mRING-C3HGC3_RFWD3 275..323 CDD:319364 19/79 (24%)
WD40 <470..>624 CDD:225201
WD40 repeat 491..528 CDD:293791
WD40 repeat 534..572 CDD:293791
WD40 repeat 579..617 CDD:293791
WD40 repeat 692..731 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1451258at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.