powered by:
Protein Alignment CG14983 and rfwd3
DIOPT Version :9
Sequence 1: | NP_647843.1 |
Gene: | CG14983 / 38466 |
FlyBaseID: | FBgn0035479 |
Length: | 163 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_002667008.1 |
Gene: | rfwd3 / 100329327 |
ZFINID: | ZDB-GENE-120529-1 |
Length: | 632 |
Species: | Danio rerio |
Alignment Length: | 64 |
Identity: | 23/64 - (35%) |
Similarity: | 35/64 - (54%) |
Gaps: | 1/64 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 101 CSICDLKCEPHGRHSMVSLRCGHLFGRHCINNVLR-ESSRCPTCSRRARHHEVRRIYGLKFYPL 163
||||.......|.|.:.:||||||||..||:..|. ..::||.|::.|:..::..:|..:...|
Zfish 151 CSICFEPWTTAGEHRLAALRCGHLFGYVCISRWLTGGGNKCPQCNKPAKKTQIIFLYARRLKAL 214
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C170579731 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D273025at33208 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.850 |
|
Return to query results.
Submit another query.