DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14982 and fam110d

DIOPT Version :9

Sequence 1:NP_001261385.1 Gene:CG14982 / 38464 FlyBaseID:FBgn0035477 Length:773 Species:Drosophila melanogaster
Sequence 2:NP_001072542.1 Gene:fam110d / 779997 XenbaseID:XB-GENE-920630 Length:377 Species:Xenopus tropicalis


Alignment Length:279 Identity:57/279 - (20%)
Similarity:94/279 - (33%) Gaps:71/279 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   531 TPTPPSPRLKTQTPRYSSSS-----SQQLHTS---SQGYTSIN------------HSQSSLVQSP 575
            ||......|..:|...||::     |.:||.|   |....::|            ...:.:|.||
 Frog   108 TPLLQRKALSLKTEHASSATIPSDMSVKLHISEPQSDKTPNVNCTSYTVQKIGEPRQDNKVVPSP 172

  Fly   576 GSAPSVDDISPPPIQFKRQR----CIRFKNRNRLPVQGEMGGPPGSGGGL--------------- 621
            .| |.....|...:..|||.    .|.::.|..: ||.|......|||.:               
 Frog   173 RS-PVTQPFSMRRVSGKRQHRPDSLIIYRQRRDI-VQNEKENNESSGGLVNRLLQNTPLLKRRIP 235

  Fly   622 VAPGSGGMGTASGVLAAYKQHRGSVDHENVFFPKGFSSEVYHNSLDMEREALNASISELEKFFDR 686
            :|.||....:.....:...|.:..         :....:|.......|..:...|.|:::.||:.
 Frog   236 LAQGSSQPCSQESPNSPRAQKKTD---------ESLMCQVPTFGAPQEAVSKEHSPSDVQHFFES 291

  Fly   687 LGLND---EAFHEIYSQPRRHHSETDDASDDSSTVFFSDVSTVDSMRLPDSTETQPQATQAYRPS 748
            .||..   :....:|           ....|::......|..:....:....|.:.:.|      
 Frog   292 CGLEGSLLDLLDNVY-----------QLGGDTTIGSLESVDRISGRSVVLHEEVKEERT------ 339

  Fly   749 EPPSIVERNARIIKWLCNC 767
             |.|::|||||:|||:.:|
 Frog   340 -PVSVIERNARVIKWIYSC 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14982NP_001261385.1 FAM110_C 663..770 CDD:290865 23/108 (21%)
fam110dNP_001072542.1 FAM110_N <16..>54 CDD:372938
FAM110_C 283..360 CDD:372937 21/93 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D326385at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR14758
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.