DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14982 and FAM110C

DIOPT Version :9

Sequence 1:NP_001261385.1 Gene:CG14982 / 38464 FlyBaseID:FBgn0035477 Length:773 Species:Drosophila melanogaster
Sequence 2:XP_016860178.1 Gene:FAM110C / 642273 HGNCID:33340 Length:350 Species:Homo sapiens


Alignment Length:330 Identity:67/330 - (20%)
Similarity:106/330 - (32%) Gaps:116/330 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   520 PEVPEAFQDDYTPTPPSPRLKTQTPRYSSSSSQQLH--------TSSQGYTSINHSQSSLVQSPG 576
            |..|.|.:|   |....|..::...|.::..::.:.        .:|:|      |....::.||
Human    17 PRDPAATRD---PDAARPARRSAVERLAADRAKYVRGRPGTGRGVASEG------SGPGAIKCPG 72

  Fly   577 SAPSVDDISPPPIQFK---------------RQRC-------------------IRFKNRNRLPV 607
            :.|.....:|.|:..:               ||:|                   .:...:::.||
Human    73 NDPGPPARAPAPVARRAIARKPLRPDSLIIYRQKCEFVRGSGADGPRASLVKKLFQGPGKDKAPV 137

  Fly   608 -----QGEMGGP------PGSGGGLVAP----GSGGMGTASGVLAAYKQHRGSVDHENVFFPKGF 657
                 :|:.|.|      ||.......|    .:......|.|.||               |.|.
Human   138 PRTGDEGKAGNPETVPTTPGPAADPAIPETPAPAARSAAPSSVPAA---------------PPGP 187

  Fly   658 SSEVY-HNSLDMEREAL----NASISELEKFFDRLGLNDEAFHEIYSQPRRHHSETDDASDDSST 717
            ...|. ...|...:..|    :|:::|.:.||...||:.|....:       ..|...|..|..|
Human   188 EPRVVRRRGLQRSQSDLSSRYSAALAESDTFFQYCGLDPEVVEAL-------GRENFTAGSDCVT 245

  Fly   718 VFFSDVSTVDS--------------MRLPDSTETQPQATQAYRPSEPPSIVERNARIIKWLCNCK 768
            :....||...|              ::..:..|..|..|         |::||||||||||..||
Human   246 LKVRSVSVATSGSGFSRHSGGDDEGLQEEELIEQVPSTT---------SVIERNARIIKWLYTCK 301

  Fly   769 KMQCT 773
            |.:.|
Human   302 KAKET 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14982NP_001261385.1 FAM110_C 663..770 CDD:290865 32/124 (26%)
FAM110CXP_016860178.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28WFT
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D326385at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14758
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.