DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14982 and Fam110d

DIOPT Version :9

Sequence 1:NP_001261385.1 Gene:CG14982 / 38464 FlyBaseID:FBgn0035477 Length:773 Species:Drosophila melanogaster
Sequence 2:NP_001102740.1 Gene:Fam110d / 500563 RGDID:1564994 Length:271 Species:Rattus norvegicus


Alignment Length:297 Identity:73/297 - (24%)
Similarity:101/297 - (34%) Gaps:98/297 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   531 TPTPPSPRLKTQTPRYSSSSSQQLHTSSQGYTSINHSQSSLVQSP----GSAPSVDDISPPPIQF 591
            :||.||   :.:||    |:.::|......|.. .|......|.|    ||.|    ::|.|   
  Rat     5 SPTTPS---RGRTP----SAVERLEADKAKYVK-THQVIVRRQEPALRGGSGP----LTPHP--- 54

  Fly   592 KRQRCIRFKNRNRLPVQGEMGGPPGSGGGLVAPGSGGMGTASGVLAAYKQHR---GSVDHENVFF 653
                |      |.|........|     |....|||........|..|:|.|   .||:.||.  
  Rat    55 ----C------NELGASASPRTP-----GPARRGSGRRQPRPDSLIFYRQKRDCKASVNKENA-- 102

  Fly   654 PKGFSSEVYHNSLDMEREALNAS-----------------------------------ISELEKF 683
             || ...|....|...|:|..:|                                   :||.|:|
  Rat   103 -KG-QGLVRRLFLGATRDAAPSSPAPTERPGAPAGWAGSPDTPEATGKRALCPTCSLPLSEKERF 165

  Fly   684 FDRLGLNDEAFHEIYSQPR-------RHHSE---------TDDASDDSSTVFFSDVSTVDSMRLP 732
            |:..|| :.|..|:....|       ..||.         :.|.||.:|:  ..|..:.|.....
  Rat   166 FNYCGL-ERALVEVLGAERFSPQSWGAEHSPQVATSPPPGSGDTSDWTSS--DRDAGSPDCAGGG 227

  Fly   733 DSTETQPQATQAYRPSEPPSIVERNARIIKWLCNCKK 769
            ..:|....|... ||:  .|:||||||:|:||..|::
  Rat   228 GGSEAAGSARDG-RPT--VSVVERNARVIQWLYGCQR 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14982NP_001261385.1 FAM110_C 663..770 CDD:290865 37/158 (23%)
Fam110dNP_001102740.1 FAM110_N <13..>41 CDD:404949 7/32 (22%)
FAM110_C 141..262 CDD:404948 33/127 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28WFT
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D326385at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR14758
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.