DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14982 and fam110a

DIOPT Version :9

Sequence 1:NP_001261385.1 Gene:CG14982 / 38464 FlyBaseID:FBgn0035477 Length:773 Species:Drosophila melanogaster
Sequence 2:XP_009302562.1 Gene:fam110a / 100004155 ZFINID:ZDB-GENE-030521-6 Length:420 Species:Danio rerio


Alignment Length:295 Identity:68/295 - (23%)
Similarity:115/295 - (38%) Gaps:68/295 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   504 QDTTMGSDYLLNFTPTPEVP--EAFQDDYTPTPPSPRLKTQTPRYSSSSSQ-----QLHTSSQGY 561
            :||::||..:....|..|.|  ...:.|..|..|..|:.::.|..|.|.:|     ||....:.|
Zfish   145 EDTSVGSTTMSQGKPAVETPTMTVRRVDVRPQLPQMRMPSRPPIQSRSPAQQTIPIQLLRMLRPY 209

  Fly   562 TSIN---------HSQSSL----VQSPGS----APSVDDISPPPIQFKRQRCIRFKNRNRLPVQG 609
            |..|         |:.:::    ::.|.|    :||.:..|.||          ..|...||...
Zfish   210 TQPNQQTFDFKRLHNVTNVTRGPIKPPNSPALISPSSNSPSLPP----------SSNSPSLPPST 264

  Fly   610 EMGGPPGSGGGLVAPGSGGMGTASGVLA----------AYKQHRGSVDHENVFFPKGFSSEVYHN 664
            :....|.|....:.|.:     .:.:||          |:.:|..:...:.....:. .|:|   
Zfish   265 KTNTEPLSSPTPITPPA-----VASLLAKNDSQSPPSPAFTRHSSTSSRKRPSLTRS-KSDV--- 320

  Fly   665 SLDMEREALNASISELEKFFDRLGLNDEAFHEIYSQPRRHHSETDDASDDSSTVFFSDVSTVDSM 729
                 .:..:.:.:|||:||:..||:.....|: ::|         .||..|.......|...|.
Zfish   321 -----SDCFSRAGAELERFFNYCGLDPSDIDEL-ARP---------GSDIVSVSRLRSASAPASE 370

  Fly   730 RLPDSTETQPQATQAYRPSEPPSIVERNARIIKWL 764
            |..:..:...:|.:..||:...|::|||||:||||
Zfish   371 RTAEGEDEDEEAAKDDRPAYGVSVIERNARVIKWL 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14982NP_001261385.1 FAM110_C 663..770 CDD:290865 28/102 (27%)
fam110aXP_009302562.1 FAM110_N <37..96 CDD:290866
FAM110_C 310..411 CDD:290865 30/115 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D326385at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14758
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.