DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10863 and AAD14

DIOPT Version :9

Sequence 1:NP_647840.1 Gene:CG10863 / 38463 FlyBaseID:FBgn0027552 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_014068.1 Gene:AAD14 / 855385 SGDID:S000005275 Length:376 Species:Saccharomyces cerevisiae


Alignment Length:351 Identity:74/351 - (21%)
Similarity:117/351 - (33%) Gaps:112/351 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LGTYTSLGGDCERATLHAIDVGYRHIDTAYFYENENE---VGA-AVQRKIAEGVIKREDIHITTK 81
            |..:...||:|              ||||..|:||..   :|. ...||:      |:.|.|.||
Yeast    59 LDAFYEAGGNC--------------IDTANSYQNEESEIWIGEWMASRKL------RDQIVIATK 103

  Fly    82 L----------------WCHFHEPKRVEYACRKTLQNFGLQYVDLYLMHWPYSYVYRGDNEMMPT 130
            .                :|..|: :.:..:.|.:|:.....::|:..:|| :.|:...:..|   
Yeast   104 FTGDYKKYEVGGGKSANYCGNHK-RSLHVSVRDSLRKLQTDWIDILYIHW-WDYMSSIEEVM--- 163

  Fly   131 DAKGEVELNDIDYLDTWREMEKLVELGLT--------------KSIGVSNFNSEQ-----LTRLL 176
                       |.|....:..|::.||::              .|.|.:.|:..|     |.|..
Yeast   164 -----------DSLHILVQQGKVLYLGVSDTPAWVVSAANYYATSHGKTPFSVYQGKWNVLNRDF 217

  Fly   177 ANCKIKPI--HNQIECHP-------ALNQKKLIALCKKNDIVVTAYCPLGRPNPAE--------- 223
            .. .|.|:  |..:...|       ....||.:...|||...:..:  :|.|...|         
Yeast   218 ER-DIIPMARHFGMALAPWDVMGGGRFQSKKAMEERKKNGEGLRTF--VGGPEQTELEVKISEAL 279

  Fly   224 -KTPNYIYDAKVQAIGDKYKKSTAQVV-----------LRYLIEIGTIPLPKSSNPKRIEENFQI 276
             |.........|.||...|.:|.|:.|           |:..||..:|.|    .|::||....|
Yeast   280 TKIAEEHGTESVTAIAIAYVRSKAKNVFPLIGGRKIEHLKQNIEALSIKL----TPEQIEYLESI 340

  Fly   277 FDFQLDAEDHAILDSYNTGERLIPMT 302
            ..|.:......|.|.....::|.|:|
Yeast   341 VPFDVGFPKSLIGDDPAVTKKLSPLT 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10863NP_647840.1 ARA1 6..304 CDD:223729 74/351 (21%)
Tas 11..290 CDD:223739 70/337 (21%)
AAD14NP_014068.1 AKR_AKR9A3_9B1-4 20..338 CDD:381373 67/321 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345926
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.