DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10863 and YJR096W

DIOPT Version :9

Sequence 1:NP_647840.1 Gene:CG10863 / 38463 FlyBaseID:FBgn0027552 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_012630.1 Gene:YJR096W / 853559 SGDID:S000003857 Length:282 Species:Saccharomyces cerevisiae


Alignment Length:293 Identity:101/293 - (34%)
Similarity:147/293 - (50%) Gaps:40/293 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YVKHNNGTQIQSIGLGTYTSLGGDCERATLHAIDVGYRHIDTAYFYENENEVGAAVQRKIAE--G 69
            :.|.:||.:|.||.||||..............:..||||.|||..|.||.|||..:.:.:.|  |
Yeast     5 FYKLSNGFKIPSIALGTYDIPRSQTAEIVYEGVKCGYRHFDTAVLYGNEKEVGDGIIKWLNEDPG 69

  Fly    70 VIKREDIHITTKLWCHFHEPKRVEYACRKTLQNF-GLQYVDLYLMHWPYSYVYRGDNEMMPTDAK 133
            ..|||:|..|||||...:..||.:.|.|:.|... ||||:||.|:|.|                 
Yeast    70 NHKREEIFYTTKLWNSQNGYKRAKAAIRQCLNEVSGLQYIDLLLIHSP----------------- 117

  Fly   134 GEVELNDIDYLDTWREMEKLVELGLTKSIGVSNFNSEQLTRLL--ANCKIKPIHNQIECHPALNQ 196
              :|.:.: .|:|||.|::.|:.||.|||||||:..:.:..||  ...|.||:.||||..|.:.:
Yeast   118 --LEGSKL-RLETWRAMQEAVDEGLVKSIGVSNYGKKHIDELLNWPELKHKPVVNQIEISPWIMR 179

  Fly   197 KKLIALCKKNDIVVTAYCPL----GRPNPAEKTPNYIYDAKVQAIGDKYKKSTAQVVLRYLIEIG 257
            ::|...||...:||.|:.||    ...||           .:..:..:..::..||::|:.::.|
Yeast   180 QELADYCKSKGLVVEAFAPLCHGYKMTNP-----------DLLKVCKEVDRNPGQVLIRWSLQHG 233

  Fly   258 TIPLPKSSNPKRIEENFQIFDFQLDAEDHAILD 290
            .:||||:...||:|.|...::|:|..|....||
Yeast   234 YLPLPKTKTVKRLEGNLAAYNFELSDEQMKFLD 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10863NP_647840.1 ARA1 6..304 CDD:223729 101/293 (34%)
Tas 11..290 CDD:223739 98/287 (34%)
YJR096WNP_012630.1 AKR_AKR1-5-like 14..266 CDD:381297 96/282 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 1 1.100 - - O PTHR11732
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.