DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10863 and YDL124W

DIOPT Version :9

Sequence 1:NP_647840.1 Gene:CG10863 / 38463 FlyBaseID:FBgn0027552 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_010159.1 Gene:YDL124W / 851433 SGDID:S000002282 Length:312 Species:Saccharomyces cerevisiae


Alignment Length:305 Identity:96/305 - (31%)
Similarity:147/305 - (48%) Gaps:65/305 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 NNGTQIQSIG-LGTYT----------SLGGDCERATLHAIDV-GYRHIDTAYFYENENEVGAAVQ 63
            |||.:|.:|. :||.|          :.........::|:.: |..|||.|..|....|||.|: 
Yeast    11 NNGNKIPAIAIIGTGTRWYKNEETDATFSNSLVEQIVYALKLPGIIHIDAAEIYRTYPEVGKAL- 74

  Fly    64 RKIAEGVIKREDIHITTKLWCHFHEPK---------RVEYACRKTLQNFGLQYVDLYLMHWPYSY 119
             .:.|.  .|..|.:|.|     :.|:         .::.|.:|    .|..||||||:|.|:. 
Yeast    75 -SLTEK--PRNAIFLTDK-----YSPQIKMSDSPADGLDLALKK----MGTDYVDLYLLHSPFV- 126

  Fly   120 VYRGDNEMMPTDAKGEVELNDIDYLDTWREMEKLVELGLTKSIGVSNFNSEQLTRLLANCKIKPI 184
                           ..|:|.:...:.|::||:|.:.|..|:||||||..|.|.|:|...::||.
Yeast   127 ---------------SKEVNGLSLEEAWKDMEQLYKSGKAKNIGVSNFAVEDLQRILKVAEVKPQ 176

  Fly   185 HNQIECHPALNQKK--LIALCKKNDIVVTAYCPLGRPNPAEK-------TPNYIYDAKVQAIGDK 240
            .||||..|.|..:.  :...|:::||:|.||.|||   |.:|       .|.:.|   |:.:.:|
Yeast   177 VNQIEFSPFLQNQTPGIYKFCQEHDILVEAYSPLG---PLQKKTAQDDSQPFFEY---VKELSEK 235

  Fly   241 YKKSTAQVVLRYLIEIGTIPLPKSSNPKRIEENFQIFDFQLDAED 285
            |.||.||::||::.:.|.:|:..||.|:||.:...:|.|.|.||:
Yeast   236 YIKSEAQIILRWVTKRGVLPVTTSSKPQRISDAQNLFSFDLTAEE 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10863NP_647840.1 ARA1 6..304 CDD:223729 96/305 (31%)
Tas 11..290 CDD:223739 96/305 (31%)
YDL124WNP_010159.1 AKR_AKR3C2-3 13..291 CDD:381346 94/303 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345958
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11732
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.800

Return to query results.
Submit another query.