DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10863 and KCNAB2

DIOPT Version :9

Sequence 1:NP_647840.1 Gene:CG10863 / 38463 FlyBaseID:FBgn0027552 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_016858110.1 Gene:KCNAB2 / 8514 HGNCID:6229 Length:435 Species:Homo sapiens


Alignment Length:238 Identity:57/238 - (23%)
Similarity:94/238 - (39%) Gaps:42/238 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VKHNN----GTQIQSIGLGTYTSLGGD-----CERATLHAIDVGYRHIDTAYFYENENEVGAAVQ 63
            :|:.|    |.::..:||||:.:.||.     .|:....|.|.|....|||       ||.||.:
Human    90 MKYRNLGKSGLRVSCLGLGTWVTFGGQITDEMAEQLMTLAYDNGINLFDTA-------EVYAAGK 147

  Fly    64 RKIAEGVI------KREDIHITTKL-WCHFHEPKR------VEYACRKTLQNFGLQYVDLYLMHW 115
            .::..|.|      :|..:.||||: |....|.:|      :....:.:|:...|:|||:...:.
Human   148 AEVVLGNIIKKKGWRRSSLVITTKIFWGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANR 212

  Fly   116 PYSYVYRGDNEMMPTDAKGEVELNDIDYLDTWREMEKLVELGLTKSIGVSNFNSEQLTRLLANCK 180
            |      ..|..|..|.....:.......:|.|.|..::..|:....|.|.::|.::....:..:
Human   213 P------DPNTPMEGDPFSSSKSRTFIIEETVRAMTHVINQGMAMYWGTSRWSSMEIMEAYSVAR 271

  Fly   181 ----IKPIHNQIECHPALNQK---KLIALCKKNDIVVTAYCPL 216
                ..||..|.|.|....:|   :|..|..|..:....:.||
Human   272 QFNLTPPICEQAEYHMFQREKVEVQLPELFHKIGVGAMTWSPL 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10863NP_647840.1 ARA1 6..304 CDD:223729 57/238 (24%)
Tas 11..290 CDD:223739 56/235 (24%)
KCNAB2XP_016858110.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.