DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10863 and AT1G60730

DIOPT Version :9

Sequence 1:NP_647840.1 Gene:CG10863 / 38463 FlyBaseID:FBgn0027552 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001185274.1 Gene:AT1G60730 / 842367 AraportID:AT1G60730 Length:365 Species:Arabidopsis thaliana


Alignment Length:368 Identity:90/368 - (24%)
Similarity:149/368 - (40%) Gaps:91/368 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 NNGTQIQSIGLGT------YTSLGGDCERATL--HAIDVGYRHIDTAYFYENE-NEVGAAVQRKI 66
            :.|.::.:.|||.      |.:...:.|...|  |||..|...:||:..|..| ||:  .:.:.:
plant    14 SQGLEVSAQGLGCMGLSAFYGTPKPETEAIALIHHAIHSGVTFLDTSDIYGPETNEL--LLSKAL 76

  Fly    67 AEGVIKREDIHITTKLWCHFHE--------PKRVEYACRKTLQNFGLQYVDLYLMHWPYSYVYRG 123
            .:||  ||.:.:.||....:.|        |..|..||..:|....:..:|||       |.:|.
plant    77 KDGV--REKVELATKYGIRYAEGKVEFKGDPAYVRAACEASLMRVDVACIDLY-------YQHRI 132

  Fly   124 DNEMMPTD--------AKGEVELND-IDYLDTWREMEKLVELGLTKSIGVSNFNSEQLTRLLANC 179
            |.. :|.:        ..||:.|:. :::.  ..|::||||.|..|.||:|..::..:.|..|  
plant   133 DTR-VPIEITLIHEEPLSGEMILSSPLEFF--IGELKKLVEEGKIKYIGLSEASASTIRRAHA-- 192

  Fly   180 KIKPIHNQIECHPALN----------QKKLIALCKKNDIVVTAYCPLGR--------------PN 220
             :.||       .||.          ::.:|..|::..|.:.||.||||              .|
plant   193 -VHPI-------TALQIEWSLWSRDVEEDIIPTCRELGIGIVAYSPLGRGFFASGPKLVENLDNN 249

  Fly   221 PAEKT----------PNYIYDAKVQAIGDKYKKSTAQVVLRYLIEIG--TIPLPKSSNPKRIEEN 273
            ...||          .|.|...||.|:.:|...:.||:.|.::...|  ..|:|.::..:.:.:|
plant   250 DVRKTLPRFQQENLDHNKILFEKVSAMSEKKGCTPAQLALAWVHHQGDDVCPIPGTTKIENLNQN 314

  Fly   274 FQIFDFQLDAEDHAILDS-----YNTGERLIPMTHAIKSKNYP 311
            ......:|..|:.:.|:|     :..|||.|.:....|:...|
plant   315 IGALSVKLTPEEMSELESLAQPGFVKGERSISILTTFKNSETP 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10863NP_647840.1 ARA1 6..304 CDD:223729 88/359 (25%)
Tas 11..290 CDD:223739 82/340 (24%)
AT1G60730NP_001185274.1 Aldo_ket_red 9..333 CDD:119408 83/342 (24%)
Tas 10..331 CDD:223739 82/340 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.