DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10863 and ATB2

DIOPT Version :9

Sequence 1:NP_647840.1 Gene:CG10863 / 38463 FlyBaseID:FBgn0027552 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_564761.1 Gene:ATB2 / 842365 AraportID:AT1G60710 Length:345 Species:Arabidopsis thaliana


Alignment Length:349 Identity:83/349 - (23%)
Similarity:139/349 - (39%) Gaps:73/349 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 NNGTQIQSIGLGT------YTSLGGDCERATL--HAIDVGYRHIDTAYFYENE-NEVGAAVQRKI 66
            :.|.::.:.|||.      |.:...:.|...|  |||..|...:||:..|..| |||  .:.:.:
plant    14 SQGLEVSAQGLGCMGLSAFYGAPKPENEAIALIHHAIHSGVTLLDTSDIYGPETNEV--LLGKAL 76

  Fly    67 AEGVIKREDIHITTKLWCHFHEPKR--------VEYACRKTLQNFGLQYVDLYLMHWPYSYVYRG 123
            .:||  ||.:.:.||....:.|.||        |..||..:|:...:..:|||..|         
plant    77 KDGV--REKVELATKFGISYAEGKREVRGDPEYVRAACEASLKRLDIACIDLYYQH--------- 130

  Fly   124 DNEMMPTDAKGEVELNDIDYLDTWREMEKLVELGLTKSIGVSNFNSEQLTRLLANCKIKPIHNQI 188
                 ..|.:..:|:       |..|::||||.|..|.||:|..::..:.|..|...|..:..:.
plant   131 -----RVDTRVPIEI-------TMGELKKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQIEW 183

  Fly   189 ECHPALNQKKLIALCKKNDIVVTAYCPLGR------PNPAEKTP------------------NYI 229
            .......::::|..|::..|.:.||.||||      |...|...                  |.|
plant   184 SLWTRDVEEEIIPTCRELGIGIVAYSPLGRGFFASGPKLVENLEKDDFRKALPRFQEENLDHNKI 248

  Fly   230 YDAKVQAIGDKYKKSTAQVVLRYLIEIG--TIPLPKSSNPKRIEENFQIFDFQLDAEDHAILDS- 291
            ...||.||.:|...:..|:.|.::...|  ..|:|.::..:.:::|......:|..|:...|:: 
plant   249 VYEKVCAISEKKGCTPGQLALAWVHHQGDDVCPIPGTTKIENLKQNIGALSVKLTPEEMTELEAI 313

  Fly   292 ----YNTGERLIPMTHAIKSKNYP 311
                :..|:|...|....|:...|
plant   314 AQPGFVKGDRYSNMIPTFKNAETP 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10863NP_647840.1 ARA1 6..304 CDD:223729 81/340 (24%)
Tas 11..290 CDD:223739 77/321 (24%)
ATB2NP_564761.1 AKR_AKR13D1 8..310 CDD:381371 77/320 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.